KEGG   Bacillus megaterium QM B1551: BMQ_0822Help
Entry
BMQ_0822          CDS       T01208                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796847..797695
Genome map
AA seq 282 aa AA seqDB search
MSTLTSQSVIKCGKYELNYADRTLIMGILNVNPDSFSDGGKYYDVDKAVAHAEEMVKQGA
DIIDIGGESTRPGYTRISDEEEIKRIVPVISEVAKRVEVPISVDTYKSEVAKHALKAGAH
IINDIWGAKADPKMAQVAADYNVPIILMHNRHEPNYTNLITDMISDLEESISIAKAAGVR
DDQIILDPGIGFGKTAAHNVEAIQHLDQLTKMGYPVLLATSRKGFIGQIVDAPPTERMEG
TAATVYAGIAQGVQMVRVHDVLEIKRFVKMADVLVGKHLFQF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactttaacgtctcaatccgtcattaaatgcggaaagtatgaacttaattatgca
gaccgtacgcttattatggggattttaaacgtaaacccggattcattttcagatggcgga
aaatactacgatgtagataaagcggttgctcatgctgaggaaatggtgaagcaaggagca
gacatcattgatatcgggggagaatcaactcgtcctggttatacaagaattagcgatgaa
gaagagattaaacggattgtgcctgttatttctgaagtggctaagcgcgtagaggtgccg
atttctgtagatacatacaagtcggaagtggccaagcatgcgctaaaagcaggagcacat
attattaacgatatatggggcgcaaaggctgatcccaaaatggctcaagttgcagctgac
tataatgttcctattattttaatgcataaccgtcatgagcccaattatacaaatctgatt
acagatatgataagtgatttggaagaaagcatatcaattgcaaaagctgcaggagttcga
gatgatcaaattattttagatccaggcattggctttggaaaaacggctgcgcataatgta
gaagcgattcagcatctagatcagctgacaaagatgggctatcctgtgctgcttgctact
tctcgtaaaggatttattgggcaaatagtcgatgctcctcctacggaaagaatggaagga
actgcagctactgtatatgcaggtattgcacaaggcgttcaaatggttcgagttcatgac
gtattagaaatcaagcgctttgtaaagatggcagatgtactggtaggaaaacatttattt
cagttttaa

DBGET integrated database retrieval system