KEGG   Bacillus megaterium QM B1551: BMQ_1131Help
Entry
BMQ_1131          CDS       T01208                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMQ_1131 (galU)
   00052 Galactose metabolism
    BMQ_1131 (galU)
   00500 Starch and sucrose metabolism
    BMQ_1131 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_1131 (galU)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMQ_1131 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109498..1110379
Genome map
AA seq 293 aa AA seqDB search
MQKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDNAPELEQNLAEKGKFELLEKVRQSSNVEIHYIRQKEPKGLGHAVWCARNFI
GNEPFAVLLGDDIVQAETPCLRQLMNEYEQTLSSVIGVQTVPENETHRYGIVDPSSNKGR
RYQVESFVEKPAAGTAPSNLAIMGRYVFTPEIFKFLEEQEIGAGGEIQLTDAIQKLNEIQ
RVFAYDFEGKRYDVGEKLGFIQTSLEFALQHEDLRKDLLVFMEQLLKEQQIKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtaagaaaagcgattattccagcagcagggttaggcacacgttttttacct
gctacaaaagcaatgccaaaggaaatgcttccgattgtagacaagcctactattcaatat
attattgaagaagcgattgagtcaggcattgaagatattattatcgtaacgggtaaaggc
aagcgtgcgattgaagatcactttgacaacgctcctgagctagaacaaaacttagctgaa
aaaggtaaatttgagctgttggagaaagttcgccagtcttcaaatgttgaaattcactat
attcgccaaaaagaaccaaaaggattagggcatgcggtatggtgtgcacgtaactttatt
ggcaacgagccgttcgctgttcttttaggagacgatattgtacaggcggaaacaccttgt
ctgcgtcaattgatgaatgagtatgagcaaacgttatcttcagtgattggtgttcagact
gttcctgaaaatgaaacgcatcgctatggtatcgtggatccttcttcaaacaaaggccgc
cgctaccaagtagagtcatttgttgaaaagccagcagcaggtacagcaccttcaaactta
gcgattatgggccgttacgtattcactcctgagatttttaaatttttagaagagcaagaa
atcggagcgggcggggaaattcaattaaccgatgcgattcaaaagctaaatgaaattcag
cgtgtgtttgcgtatgattttgaaggcaagcgctatgacgtaggagaaaaattaggcttt
atccaaacatcactggagtttgctcttcagcacgaagatttgcgtaaagatcttcttgta
tttatggagcagctgctaaaagagcagcaaatcaaagcttaa

DBGET integrated database retrieval system