KEGG   Bacillus megaterium QM B1551: BMQ_1220Help
Entry
BMQ_1220          CDS       T01208                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMQ_1220
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMQ_1220
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMQ_1220
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BMQ_1220
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMQ_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1204194..1205849
Genome map
AA seq 551 aa AA seqDB search
MKKKLAGITLAGAVALASFGVGNSLIQTEAKVEHKSAKKPQNVIMMVMDGTSSNATTLAR
WYKGKPLHMDQLMAGGVRAYSAESAITDSAPAATALATGNKSNSGYVGVLPSVVNTPGVK
SVEKEDQFRPVANVLEGAKLSGRATGIVATSEIQHATPAGFSAHNYSRDDFQTLAEQQVY
QNIDVVLGGGKQSLLPGKEEKSRKDGENLVNVLNKRGYDFVENKKELEQSRAKKIWGSFA
DRDLAYDMDRPQTKAEQPKLSQMTNKAITTLSKDKDGFFLFVEGSKTDWAAHANDPIGMI
SDVLAFDEAVGKAVEFAKKDGNTMVIAIADHGNSGLSIGNANTTKGYDTTPVSAYIDPLK
KAKMTLEGATSKLKEDLSNKEEVAALYGLSNLTSEEKAQLTKTRDKKEISATLSKLLANR
ANLGFTTGGHTGEDVFLYSYGVNRPTGHFDNTDIAKHMAKSMNINLNELTNELFIEANKA
FKGSKVAVDSKDKNNPVLVVTNNKRTVRFPVNKNIAIVNGREIQMDSVVVQDKKNRFFVS
KQAQQIVKNEK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaattagcaggtattacactggcaggagcagtagcattggcctcgtttggt
gtaggaaactcacttattcaaacggaagcaaaagtggagcataagtcagctaagaaacct
caaaatgtcattatgatggtaatggacgggacgagttcaaatgctactacacttgcaaga
tggtacaagggaaaaccgttacatatggatcagctgatggccgggggagtacgtgcgtat
tcggcagaatctgctattacagattccgctccggcagctactgctttagcaacaggaaat
aaatcaaattcaggttatgtaggtgtgcttccttcagtagtgaatacacctggggttaaa
tccgtagaaaaagaagatcaatttcgtcccgtagcaaacgttctagaaggagcaaagctt
tcagggcgcgcgacaggaattgtggctacttctgaaatccagcacgccacaccagctggt
ttttcagcccacaactatagccgtgatgattttcaaacgctagcggagcagcaagtgtat
caaaacattgatgtagtgcttggaggaggtaagcaatctcttcttccaggaaaagaagaa
aaaagccggaaagacggtgaaaacttagtcaatgtattgaataaaagaggatatgacttt
gtagaaaataaaaaggaattagagcagtcacgcgccaaaaaaatctgggggagcttcgcc
gaccgagacttagcgtatgatatggaccgaccgcagacaaaagcagaacagccaaagttg
tcccagatgacaaataaagcaataacaacactatccaaagataaagacggttttttctta
tttgttgaaggaagcaaaaccgattgggcagctcatgcaaatgatccaataggaatgatt
agcgatgtactagcgtttgatgaagcagtgggcaaagcagtagagttcgctaaaaaagat
ggaaatacgatggttattgcgattgccgatcacggaaacagcggtctttcaattggtaat
gcaaatacaacaaaaggatacgataccacacctgtttctgcttatattgatccattaaaa
aaagcaaaaatgacgttagaaggtgctacgtctaaattaaaagaagatttatcaaataaa
gaagaagtagctgctttgtatggtttatcaaatctaacttcagaggaaaaagcgcagctg
actaaaacaagagataaaaaagaaatcagtgctacactatcgaagttattagccaaccga
gcaaaccttggattcacaacaggcggtcatacgggtgaggatgtatttctgtattcatac
ggcgtaaatcgaccaacggggcactttgataatacggatattgccaaacatatggctaaa
tcaatgaatattaacttaaatgagttaacaaatgaattatttattgaagcgaataaagct
tttaaaggctcaaaggtagcggttgactcaaaagacaaaaacaaccctgtgctggttgtt
acaaacaataagcgaacggtgcgtttcccagtaaataaaaatattgctattgtaaatgga
agagaaattcaaatggacagcgtagtggtacaggataaaaagaatcgcttctttgtatcg
aaacaagcacagcaaattgtaaaaaatgaaaaataa

DBGET integrated database retrieval system