KEGG   Bacillus megaterium QM B1551: BMQ_1881Help
Entry
BMQ_1881          CDS       T01208                                 

Gene name
acoC
Definition
acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bmq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmq00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmq00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmq00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1881230..1882459
Genome map
AA seq 409 aa AA seqDB search
MAAEVVMPKLGMAMKEGTVSTWNKKVGDSVSKGDMIASINSEKIEMEIEAPQDGVILDIL
VQEDVGVPPGTIICYVGNPNEQLTEQNSSANELQAPKNEVAAAISLEEPPANAASSKKSK
ETVRISPIARKIAESENINIETIQGTGPKGRITKADVEKVLAERASESSPQTVERDNPAI
NKETLPVAGMRKVIAGRMHNSLLNSAQLTINMKADVTDLLSLQREIKEVIQQRHSVKISL
TDFIARAVVLSLQEHKQMNSAYIDNEIQLYNHVHLGMAVALENGLVVPVVQHAEKMSLVE
LAAEIKTRAADARQGQLSTDRMQGSTFTITNLGAYGVEYFTPVLNPPETGILGVGATEDV
PMYKGDDLQRRNVLPLSLTFDHRVLDGAPAANFLGTIKQYLEQPILLLL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaggttgtaatgccaaaactaggtatggcaatgaaagaaggaaccgtttcg
acatggaataaaaaagttggagactccgtttcaaaaggagatatgattgcaagcattaat
tctgaaaaaatagaaatggaaattgaagctccgcaggacggtgtgattcttgatatcctt
gtacaagaagatgtaggtgtgcctcctggaacgattatctgttatgttggaaatccaaac
gagcagcttactgagcaaaacagttcagcaaatgagcttcaggctcctaaaaacgaggta
gcggctgctatctctttagaagagccaccagcaaacgcagcttcatcaaagaagagcaaa
gaaactgtgcgcatttcaccaattgcacggaaaatagcagaatctgaaaacattaatatt
gaaacgattcaaggcacaggaccaaaaggaagaatcaccaaagcagatgtagagaaagtg
ctggcggaaagagcttcagaatcgagtccccaaacggtagaaagagataaccccgctata
aacaaagaaacgcttccagtagcgggcatgaggaaagtcattgcaggccgaatgcataat
agcttattaaacagtgctcaattaacgattaatatgaaagctgacgtgacggatttgctg
tctcttcaacgagaaattaaagaagtgattcaacaacgccatagtgtaaaaatatctctg
accgattttattgctcgtgctgtcgttctttcacttcaagaacacaagcaaatgaacagt
gcttatatcgataacgaaattcaactctataaccatgttcatcttggaatggccgtagct
ttagaaaatgggttagttgttcctgttgtgcagcatgctgaaaagatgtcgttagttgaa
ttagctgcagagattaaaacacgagcagcggatgctcggcaaggtcagctgagcactgat
aggatgcaaggttcaacattcactattactaatctcggtgcttacggagtagagtatttt
acacctgtattaaatccgcctgaaacaggaatccttggtgttggagctactgaagatgta
cctatgtataaaggagacgatttacaaagaagaaacgtgctgcctttaagcctgacgttt
gatcatcgcgtactggacggggcacctgcagctaatttccttggaactattaaacaatac
ttagaacagcctattttactactcttatag

DBGET integrated database retrieval system