KEGG   Bacillus megaterium QM B1551: BMQ_1900Help
Entry
BMQ_1900          CDS       T01208                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BMQ_1900
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BMQ_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907282..1909237
Genome map
AA seq 651 aa AA seqDB search
MYIGVDYYPEHWPENMIEEDIQGIKELGSNMVRIGEFAWHLMEPKEGHYDFSFFDSVINK
LKKQNIDVMFGTPTATFPAWLAKQHPSILSKDENGAVRAFGGRRQYCFNSPLYRKYSAQI
TEQLVKHYCSEEAIVAWQVDNEFGHEGSDMCYCEQCHKEFQQFLERKYKDINELNEKYGT
IFWGQTYNEFTEVPMPVKTITTHSPSLKLDWARFRSFSLNRYAHEQTAIVKKYKGDHQLL
TTNVSGGFFDKWFDHEENLEVMDFVSYDNYPVWGGQTEPITPAHIALGHDFNRGLLHKNF
WIVEELMGAQGHDVIGYLPRPNQAKMWSYQAFAHGCTNMLYFRWRGMTRGAEQYCYGVVG
HDNHYGRRYKEVQSLFSEIVHYEHVLESDIKSDVAVLYDYENIWSWRFQQQSEGFDFTQE
LLRGYTPFYKLNTPIDVIPASRDFSSYKVLVVPALQIIDEELGKRFTEFTENGGVIIFTF
RTGIKDKQNNIHFKQTLPGYVKEITGIEIHEVEALSSTQKAAIKGKGPYEGEESSASVWR
DIITPVTAEVLYEYDDPFYNQAAVTKNQFGRGTVYYVGCGIEEQTFEKIALDIVKQQHIE
HRESEDGIEVYPRKLGEKSYYFLMNHTSEVKVFKDIVLQPYESRVVENIQP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcggcgtcgattattaccctgaacattggccagagaatatgatagaagaagat
atccaaggcattaaagagctaggatcaaacatggtgagaataggagagttcgcttggcac
cttatggagcctaaagaagggcactatgacttttccttttttgatagcgttatcaataag
cttaaaaaacagaatattgatgttatgtttggtacgcctactgccacttttccggcttgg
cttgcgaagcagcatccttctattttatcaaaagatgaaaacggggcggtcagagccttt
ggaggaagacgtcaatattgttttaattcgcctctttaccggaagtatagcgcccagatt
acagaacaactcgtaaagcactactgctcagaagaagcaatcgtagcatggcaagttgac
aatgaatttggccatgaaggcagtgacatgtgttactgcgaacaatgtcataaagagttt
cagcagtttttggaaagaaaatataaagatattaatgagctaaatgaaaagtatggcact
attttctggggacaaacatataacgagtttactgaagtgcctatgcctgtaaaaacaatt
acgacacacagcccttcgctaaagcttgactgggcgcgctttcgctctttttcattaaac
agatacgctcacgaacaaacggcgattgtgaagaaatataaaggtgatcaccagctgttg
acaacgaacgtatcaggaggcttctttgataaatggtttgatcatgaagaaaatctagaa
gtaatggactttgtatcctatgacaattatccggtatggggcggtcaaacagagccaatt
actccggctcatattgcactagggcatgattttaatagaggcttgctacataaaaacttc
tggattgtagaggaattaatgggcgctcaaggtcatgatgtcatcggttatcttccgcga
cctaaccaggcaaagatgtggtcttatcaggcttttgctcatggatgtacgaatatgctg
tatttccgttggcgcggaatgacaagaggagccgagcaatactgctatggagttgtaggt
catgataatcattatggaagacgctacaaagaagttcagtcgttatttagtgaaatcgtt
cattacgaacatgtacttgagtctgatattaaatccgatgttgccgttttatatgactat
gaaaatatatggtcatggcgctttcagcagcaaagtgaaggatttgactttacgcaagag
cttcttagaggatatacaccgttttataagttgaatacacctattgatgttattcctgct
tcgagagatttttcaagctataaagtactggttgttccggctttgcaaatcattgatgaa
gaactaggtaagagatttactgaatttactgaaaacggcggcgtgattatttttactttt
agaaccggcattaaagacaaacaaaataacattcattttaaacagacgctcccgggatat
gtaaaagaaataacaggaattgaaattcatgaagtggaagcactgtcttctactcaaaaa
gcagctattaaaggaaaaggaccgtatgaaggagaagaatcaagtgcgtccgtgtggaga
gatattatcacgcctgtaacagctgaagtgctgtatgagtatgatgatccattttataat
caagcagctgtaacaaaaaatcagtttgggcgcggaacggtttattatgtaggctgtgga
attgaggagcaaacgtttgaaaaaattgcgcttgatattgtgaaacagcagcatattgag
catagagaaagtgaagatggaattgaagtatatcctcgcaagcttggagagaaaagttat
tacttccttatgaaccatacgtcagaagtaaaagtatttaaagatattgttctgcagcct
tacgaaagtcgagttgtggaaaatatacagccgtaa

DBGET integrated database retrieval system