KEGG   Bacillus megaterium QM B1551: BMQ_1923Help
Entry
BMQ_1923          CDS       T01208                                 

Definition
(RefSeq) phosphoglycerate mutase family protein (EC:5.4.2.-)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_1923
   01230 Biosynthesis of amino acids
    BMQ_1923
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_1923
  Energy metabolism
   00680 Methane metabolism
    BMQ_1923
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_1923
Enzymes [BR:bmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMQ_1923
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMQ_1923
  Exosomal proteins of melanoma cells
   BMQ_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1931408..1931977
Genome map
AA seq 189 aa AA seqDB search
MKTFILIRHCKAEGQEEGALLTEEGKKEASDLITHLNKLNCNITKIISSPYERAVKTIEP
YAKEIGLSIQIDNRLSERRLSNKSLSNWLELLKQTFDDIDLIIEGGESTREATERAISLI
REEIEFSKEQNTLLVTHGNLMSLILRYFDESFGFNEWENLTNPDVYRIDINDNQINITRL
WDPTAFSNI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttatactgataagacattgtaaggcagaggggcaagaagaaggggcgtta
ttaactgaagaaggaaaaaaagaagccagtgatcttattactcacttaaataaattgaac
tgtaatattactaaaattatttcgagtccatatgaaagagctgtaaaaacaattgaaccc
tatgcaaaagagatagggttaagtatacaaattgacaatagattatcagaaagaaggtta
agtaataaatcacttagtaattggttagagctattaaaacaaactttcgatgatatagat
cttattattgaaggaggagaatccacaagagaagctacagaacgtgcaatcagtcttatt
agagaggaaatagaatttagcaaagaacagaatacgttattagttacacatggaaacctt
atgagtttaattcttagatattttgacgaaagttttggttttaatgagtgggaaaactta
acgaacccagatgtttatagaatagatattaatgataatcaaattaatataacaagacta
tgggacccaacggcattcagtaatatctag

DBGET integrated database retrieval system