KEGG   Bacillus megaterium QM B1551: BMQ_1984Help
Entry
BMQ_1984          CDS       T01208                                 

Definition
glutathione peroxidase family protein (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bmq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bmq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1989978..1990454
Genome map
AA seq 158 aa AA seqDB search
MSVYEYSAKTIKDEDVSLSNYQGDVLLIVNTASKCGFTPQYKDLQALYEEEKENGLTVLG
FPCNQFGGQEPGSSNDIEQFCELNYGVSFPMFAKVDVKGEHAHPLFTYLTEQAPGLLGSK
GIKWNFTKFLVNRQGEVVKRYAPQTAPKDIKKDIKELL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgtatgaatactcggcaaaaacaattaaagacgaagacgtatcgctatctaac
tatcaaggtgacgtgctgttgattgtgaatacagctagcaaatgcggcttcacccctcaa
tataaagatttgcaggcgctgtacgaagaagaaaaagaaaacggcctaacggttctaggt
tttccttgcaatcagttcggtggtcaagagccaggaagttcaaatgatattgaacaattt
tgcgagttaaactatggcgtttcgtttccgatgtttgcaaaagtagatgtaaaaggggag
catgcacacccgttatttacatacttaacagaacaagcaccgggtctactaggttccaaa
gggataaagtggaatttcacaaagtttttagtgaatcgtcaaggtgaagtcgtgaagcga
tacgcacctcaaactgcaccaaaagatattaaaaaagatataaaagaattgctgtaa

DBGET integrated database retrieval system