KEGG   Bacillus megaterium QM B1551: BMQ_2259Help
Entry
BMQ_2259          CDS       T01208                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2257753..2258736
Genome map
AA seq 327 aa AA seqDB search
MPKYQPKNSFESPRFCGPRTFMRLPYVEQVNSEMDFIVTGIPFDSGQSFRTGARFGPEAI
RDFSILLRPYNPEQKINIFDYISGVDYGDLSVVPGYILETYKKIEEGLTPVVNEGIIPIS
LGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSYFEQKYNHGTVFRRAIEEGLIDVS
RSIQIGMRGGLYGIEDLEDAKNLGLALYATNEYKKLGVERMLDIIHERVGEGPVFLSFDI
DFLDPVYAPGTGTPEVSGASIDDALQFVRGLTNIDFVGFDLVEVLPAYDHGQITAAAAAN
IVYEFITLIALRKKTKEEEALLMKARD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatatcagccgaaaaattcatttgaatctccgcgtttttgcggacctcgaaca
tttatgagacttccgtatgtagaacaagtaaattcggaaatggattttattgtcacgggt
attccgtttgattcaggtcaatcttttcgaacaggagcacgttttggaccggaagctatt
cgagatttctccattttgcttcgcccgtataacccagaacaaaagattaatatttttgat
tacatttcaggcgttgactacggcgatttgtcagttgttccgggatatattttagaaaca
tataaaaaaattgaagaagggttaacgccggttgtgaatgaaggaattattcctatttca
ctaggcggtgatcattcgatgacgctcggcgaacttcgtgccatcgcgaaaaagcacggg
ccggtagcgcttttacagtttgatgctcattctgatacgtgggatagttattttgaacaa
aaatacaatcacggtacggtatttagacgagcaattgaagaagggttaatagacgtatcg
cgatcgattcaaatcggtatgcgaggcggtctgtacggaattgaagatttagaagatgca
aagaacttaggtctagctctgtatgcgacaaatgaatataaaaaactgggcgttgaaaga
atgctagatattattcatgagcgtgtaggagaaggacccgtatttttatcgtttgacatt
gactttttagatccagtttacgcgccgggaacaggaacgcctgaagtatcgggtgcaagt
attgacgatgcgcttcaattcgttcgtgggttaacaaatattgattttgtcgggtttgat
ttagtagaagtactgccagcttatgaccatggacaaattacagcagcagcggccgctaat
attgtttatgaatttatcacgcttatcgcgttaagaaaaaaaacaaaagaagaagaagcg
ctgttaatgaaagcgcgcgactga

DBGET integrated database retrieval system