KEGG   Bacillus megaterium QM B1551: BMQ_2288Help
Entry
BMQ_2288          CDS       T01208                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00330  Arginine and proline metabolism
bmq00332  Carbapenem biosynthesis
bmq01100  Metabolic pathways
bmq01130  Biosynthesis of antibiotics
bmq01230  Biosynthesis of amino acids
Module
bmq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMQ_2288 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BMQ_2288 (proJ)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BMQ_2288 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ADIP
Motif
Other DBs
NCBI-ProteinID: ADE69313
UniProt: D5DRV0
Position
2291921..2293027
Genome map
AA seq 368 aa AA seqDB search
MSPDNKKRVVIKIGSSSLTSSHGEISRRKLERLVDQVVDLKDSGHEVLLVSSGAVAAGYR
KLGCLERPSSLPEKQAAASIGQGLLMEAYSELFLSHGYVASQILITRDDFSDENRYNNAR
NTINVLLERGIVPIVNENDTVTINRLKFGDNDTLSAKVAGLVDSDLLIILSDIDGLYSAD
PRQDPNAKLVPHVGEITQEIEESAGDSGSSVGTGGMRSKIDAFKIAMASGIPAFLGRAGV
PNILTQAVDGDATGTYFESEDDSANLNQKKQWIAFNSGPEGEIVVEDAAKRAIIEDKEPL
LREHVKYIKGHFSERAVVRILDKDENELALGVTNYSSDELALNEPIDQPIVDSEGLVCHL
EIPVPVGL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtcccgacaataagaagcgggttgtaattaaaattggaagtagttcattaacaagt
tcacacggcgaaatcagcagacggaagctcgagcgccttgtggatcaagtcgtagactta
aaagatagcggtcatgaagtgctgttggtttcatcaggagctgtagctgcagggtaccgc
aagcttggctgcttagagcgacctagctctttacctgaaaaacaagcagctgcctcaatc
ggtcaaggactgttaatggaagcttattcagaactgtttctatcacatggatacgttgct
tctcaaatcttaattacaagagacgatttttcagacgaaaatcgttacaacaatgcacga
aatacaattaacgtgctgttagaacgcggcattgtgccaattgtcaatgaaaacgatacg
gtaaccatcaatcgattaaaatttggcgataatgatacactttcagctaaagttgctgga
ctagtggattccgacctgcttattattttatcggatatcgatggcttatacagcgcggac
cctcgccaggatccaaatgcaaaattagttcctcacgtaggggaaatcacgcaagaaatc
gaagaatctgcaggagattcaggaagttcagttggaacaggcggtatgcgctcgaaaatt
gacgcgttcaaaattgctatggcctcaggaattccagcatttttaggaagagccggcgtg
ccaaacatcttaacacaagcggttgacggagatgcaacaggaacgtattttgaatctgaa
gatgattctgcgaaccttaatcagaaaaagcagtggattgcgtttaactctggtcctgaa
ggggaaatagtagtcgaagatgccgcgaaacgtgcaattattgaagataaagagccttta
cttcgcgagcatgttaaatatattaaaggccactttagtgaacgagcagttgtacgtatt
ctagataaagacgaaaatgagctggctcttggcgtgacaaattattcatctgatgaactt
gcactgaatgagccaattgatcaaccgattgtagacagcgaaggtctagtgtgtcactta
gaaattccagtaccggtcggtttgtaa

DBGET integrated database retrieval system