KEGG   Bacillus megaterium QM B1551: BMQ_2336Help
Entry
BMQ_2336          CDS       T01208                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmq00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmq00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2336929..2337705
Genome map
AA seq 258 aa AA seqDB search
MVENQVIVITGAARGIGFEIGKRFAENGGKIVLSDIDQAAVEAAAQNLREAGFEALGVKA
DVTKEEEIKHLIETANAHFGAVHTFINNAGLQHVSPIEEFPTEKYELMIKIMLTAPFMAI
KHAFPIMKKQGFGRIINVSSINGLIGFAGKAAYNSAKHGVIGLTKVAALEGAAHGITVNA
LCPGYVDTPLVRGQLDGLAKTRNVPLESVLEEVIYPLVPQKRLLDVSEIADYAIFLASDK
AKGVTGQAVVMDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaatcaagtaattgtaatcacaggagcagcaagaggaattgggtttgaaata
ggtaaacgattcgcagaaaacggtggaaaaattgtgttatccgacattgatcaagctgct
gtagaagctgcagcacaaaatcttcgtgaagctggatttgaagcgcttggtgtcaaagcc
gatgtaacaaaagaagaagaaatcaaacatttaattgaaacagcaaacgcgcattttgga
gcggttcatacgttcattaataacgctggcttgcagcatgtttctccaatcgaagagttt
ccaactgaaaaatatgagttaatgatcaaaattatgctaacagctccatttatggcgatt
aagcacgcgtttccgattatgaaaaaacaagggttcggacgtattattaacgtttcttct
atcaacggtttaatcggttttgcgggcaaagcagcttataacagtgctaaacacggtgta
attgggctaacaaaagtagctgctcttgaaggcgcagcacacggtattacggtgaatgca
ctttgtcctggctatgtggatacaccactagtgagaggtcagttagatggtttagctaaa
acaagaaatgtaccattagagagcgtgcttgaagaagttatttatcctttagtccctcaa
aaaagattactagacgtgagcgaaattgctgactatgctattttcttagcgagtgataaa
gcaaaaggtgtaactggtcaagcggtagtaatggacggcggatatacagctcaataa

DBGET integrated database retrieval system