KEGG   Bacillus megaterium QM B1551: BMQ_2857Help
Entry
BMQ_2857          CDS       T01208                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_2857 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMQ_2857 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_2857 (glcB)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMQ_2857 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2840823..2843000)
Genome map
AA seq 725 aa AA seqDB search
MTNYKQVGNLKVAPVLYQFINEEALPGSGLSTENFWSDFEALVTELTPVNKRLLEKRDQL
QAQINAWHQENPDGDFNEYKSFLTRIGYLEDKTEDFLIGTEGVDSEIAYQAGPQLVVPVN
NARYAINAANARWGSLYDALYGTDAISEENGASRTSSYNPIRGEKVIAFAKNFLDEVVPL
VQSSHAEVVQYSLENGKLVAQLNDGSLTELQEEEKFVGYQGEEESPDALLFKNNGLHFEA
QIDRTDSIGKTDDAGVKDILMEAALTTIMDCEDSVAAVDAEDKVDVYRNWLGLMKGDLTS
TFKKGSQNITRRLNPDRTYISPGKKKISLSGRSLMFVRNVGHLMTNSAVLDRNGNEIYEG
ILDSVITSLIAKHTLLKNGTYQNSKKSSIYIVKPKMHGSKEVAFANTLFNSIEDMLGLER
HTIKIGVMDEERRTTLNLKACIKEVKDRVAFINTGFLDRTGDEIHTSMEAGAVIRKNDMK
ASRWLQGYEQSNVNVGLASGFQGRAQIGKGMWAMPDMMAEMLKQKVGHLKAGANTAWVPS
PTAATLHALHYHQIDVRDVQNELLTQSTDLQDDILQIPVAEKPNWSKDEIQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHVANWLHHGICTKEQVTETLKR
MAKVVDQQNENDPLYQPMASNYSTSIAFQAACDLVFQGYDQPNGYTEPILHRRRIEAKAK
AAIKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaactacaaacaagttggaaatctaaaagtagctccagttctctatcaatttatc
aatgaggaagctcttccgggcagcggcctaagtacagaaaatttttggtctgattttgaa
gcgttagtaaccgagttaacacccgtaaataaacgtttgttagaaaagcgtgatcagctg
caagctcaaattaatgcgtggcatcaagaaaatcctgacggtgactttaacgaatacaaa
tcgtttttaacgagaattggctatttagaagacaagacagaagatttccttattggtaca
gaaggagtagacagcgaaattgcctatcaggcaggaccgcagcttgttgtacctgtaaat
aatgcccggtatgctattaacgctgctaatgcacgttggggaagtctctatgatgctctt
tacggcactgatgcaatcagtgaagaaaatggagcttcgcgcacgagttcttataatcca
attcgaggagaaaaagttattgcgtttgcgaagaattttcttgatgaagttgttccgctc
gttcagtcttctcatgcggaagtggttcagtacagccttgaaaatggaaagcttgtcgct
caattaaacgatggcagtttaaccgaattacaggaagaagagaaatttgtagggtatcaa
ggggaagaagaaagccctgatgctcttttattcaaaaacaacgggctgcattttgaagct
caaattgatcgtacggattcgattggtaaaacagacgatgcgggtgtaaaagatatttta
atggaagcagctcttacgacgattatggactgtgaagattcagtagcggcagtagacgca
gaagataaagtagatgtttaccgcaactggctgggattaatgaaaggtgatttgacgtct
acttttaaaaaaggaagtcaaaacataacaaggcgtttaaatccagaccgtacctatatt
tctcccggcaagaaaaagatttcactgtctggccgttcgcttatgtttgttcgaaacgtt
gggcatttaatgacaaacagcgctgttttagatcgaaatggcaacgaaatctatgaaggt
attttagacagcgtgattactagtttaattgccaaacacaccttgcttaaaaacggcacg
tatcaaaattctaaaaagagctctatctatatcgttaaaccgaaaatgcacggctccaaa
gaagtggcttttgccaacacgttatttaattcaattgaagatatgctagggcttgagcgt
catacgattaaaattggcgtaatggacgaagagcgccgcacgacgcttaatttaaaagcg
tgtatcaaagaagtaaaagaccgagtggcttttattaatactggattcttggatcgaaca
ggtgacgaaattcatacctcaatggaagcgggcgctgttatccgtaaaaatgatatgaaa
gcgtctagatggcttcaaggctacgagcagtctaatgtaaatgtaggattagcaagcgga
ttccaaggccgcgctcaaatcggaaaaggaatgtgggcaatgccggatatgatggcggaa
atgcttaaacaaaaagtggggcatttaaaagcaggagcgaatacggcatgggtaccttca
ccaacagcagcaacgcttcatgctcttcactatcatcaaattgatgtaagagatgttcaa
aacgaattgcttactcagtctactgatttacaagatgacattttgcaaattcctgtggca
gaaaaaccaaattggagcaaagatgaaattcagcaggagctcgacaacaatgctcaagga
atacttgggtatgtagtgagatgggtcgaccaaggagtagggtgctcaaaagtaccggat
attaataatgtagggctaatggaagaccgggcaacgcttcgtatttccagtcagcacgta
gctaactggcttcatcatggaatttgtacaaaagaacaagtaacggaaacgctaaagcga
atggcaaaagtagtggatcaacaaaatgaaaatgatcctctgtatcagccaatggcatcg
aactacagcacatccattgcttttcaggcagcctgcgatttagtatttcaaggctatgat
cagccaaacggttatacggagccaattttacaccgtcgccgtatcgaagcaaaggcaaaa
gcagctataaaacagtaa

DBGET integrated database retrieval system