KEGG   Bacillus megaterium QM B1551: BMQ_2896Help
Entry
BMQ_2896          CDS       T01208                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase, E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmq01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmq00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bmq00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2876570..2877865)
Genome map
AA seq 431 aa AA seqDB search
MGEIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLA
GEGDTVQVGETIARLEAKEGASAPAAPKAEEKPAEEAPKQEAAPAQQKTVEEVAPAAEAP
QQGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSYADQKSNEQKQQAQA
SKPATPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA
LRKRRKDKFFEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIAVSA
PDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLSLKDLQGGTFTITNGGVFGSLMST
PILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggagagattaaagtaccggaattagcagaatcaatttctgaaggaacagttgcacag
tggctaaaacaagtaggagatttcgttgaaaaaggcgattatatcgttgaacttgaaaca
gataaagttaacgttgaaattacagctgaagactctggtgtattaacggaacttcttgct
ggcgaaggcgacacagtgcaagttggtgaaacaattgcacgtcttgaagcgaaagaagga
gcttcagcaccagcagcaccaaaagctgaagaaaaaccagcagaggaagcaccaaagcaa
gaagcggctccagctcagcaaaaaactgttgaagaagtagcgccagcagctgaagcgcct
cagcaaggaaatcaaaaacaatggctaattgcttctcctgcagctcgtaaagcagcaaga
gaacgcgggattaagctagatcaagtgccaactactgatcctcttggccgtgtgcgcaaa
catgatattgattcgtatgcagaccaaaaatcaaatgagcaaaagcagcaggcacaagca
agtaagccagctaccccggtatctccgtctccagcggcaagtgaaaatagcgacaaacct
gttgaacgcgaacgtatgtcacgtcgtcgtcaaacaattgccaaacgtcttgttgaagtt
cagcaaacagcggctatgctaacaacgtttaacgaagtagacatgactgctgttatggct
cttcgcaaacgacgcaaagacaaattctttgaacagcacgacgtaagacttggctttatg
tcattctttacaaaagcagtagtagcagcacttaaaaagtatccattattaaatgctgaa
attcaaggaaacgagttattaattaaaaaattctatgatatcggtattgctgtgtcagct
ccagacggtcttgttgttccagttgtacgtgatgctgaccgcaaaacattcgctggtatc
gaaggatctatcgttgatttagcgaaaaaagcgcgcgacaacaaattatcattaaaagat
ttacaaggtggaacgttcacaattacaaacggcggcgtattcggttcattaatgtctaca
ccaattttaaacggacctcaagttggtattttaggaatgcacaaagttcagcttcgtccg
gtagcaattgatgaagagcgtatcgaaaatcgtccgatgatgtacattgcactttcttac
gatcaccgtatcgttgacggcaaagaagccgtaagcttcctagctactgttaaagaacta
ttagaagatccagaatctttattactagaaggttaa

DBGET integrated database retrieval system