KEGG   Bacillus megaterium QM B1551: BMQ_3052Help
Entry
BMQ_3052          CDS       T01208                                 

Gene name
citA
Definition
(RefSeq) citrate synthase I (EC:2.3.3.1)
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_3052 (citA)
   01210 2-Oxocarboxylic acid metabolism
    BMQ_3052 (citA)
   01230 Biosynthesis of amino acids
    BMQ_3052 (citA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_3052 (citA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_3052 (citA)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BMQ_3052 (citA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3026444..3027547)
Genome map
AA seq 367 aa AA seqDB search
MTYVKGLEGIIAAETKVGHVDGEKGQLIYRGYWAKDLAINYSFEEVSYLIWNGTLPNHDE
LKAFKQKMVTHRTLPANIVALMDCLPKDTEVMSALRTCISALGDPSYSWPPTKEQALAIT
AVTPTIIAYWYRKMNDLEVVEPNEHLDHVANYLYMINGEIPDQSLVTALNAYFVLTIEHG
MNASTFSSRVISSTESDMVSAICGAIGAMKGPLHGGAPSGVITMFDEIGSEENIEPWVRK
KLDNKEKIMGFGHRVYRTHDPRAEALKEVSKQISGDNGLFDLIVKIEDKTIELLNEYKPG
RGIYTNVEYFAAAVMKAVELPSELFTPTFTASRVVGWTAHVVEQSENNRIYRPQSAYIGY
TPVEQNQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgttaaaggactagaaggaatcattgcagctgaaacaaaagtagggcatgtt
gatggagagaaaggtcagctgatttatcgcggatattgggcaaaagatttggcgatcaat
tattcttttgaagaagtttcttatttaatttggaacggcacgctgccaaatcatgatgag
ttaaaagcatttaaacaaaaaatggtgactcatcgtacgcttccagctaatattgttgcg
ttaatggactgtttgccaaaagatacagaagtgatgagcgcgcttcgcacatgtatctca
gcattaggagacccttcatacagctggcctccgacaaaagagcaggcgcttgcgattaca
gcggtaacacctaccattattgcctattggtatcgtaaaatgaatgatttagaagtagta
gaacctaacgagcatttggatcatgtagcaaactatttatatatgattaacggggaaatt
ccagatcaaagtttggttactgcgctgaacgcatattttgttttgacaattgaacatggg
atgaacgcctcaaccttctcatcacgcgttatttcatctaccgaatctgacatggtttca
gctatttgcggagcaattggcgcgatgaaaggtccgcttcacggaggagctccttctggt
gttattaccatgtttgatgaaattggaagtgaagagaatattgagccttgggttcgtaaa
aaattagataataaagagaaaattatgggatttggtcatcgcgtttatcgtacacatgac
ccaagagcagaagcattaaaagaagtatcgaaacaaatctcaggagacaacgggctattt
gatttaattgttaaaattgaagataaaaccattgaattactcaatgaatacaagccgggt
cgaggcatttataccaatgtagaatatttcgctgcagcggttatgaaagcggttgagctt
ccgtctgaactattcacaccaaccttcacagcaagccgtgtagttggctggacagctcat
gtcgtagagcagtcagaaaataatcgtatttaccgacctcagtctgcgtatataggttat
acgccagttgaacaaaatcaataa

DBGET integrated database retrieval system