KEGG   Bacillus megaterium QM B1551: BMQ_3052Help
Entry
BMQ_3052          CDS       T01208                                 

Gene name
citA
Definition
citrate synthase I (EC:2.3.3.1)
Orthology
K01647  
citrate synthase [EC:2.3.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_3052 (citA)
   01210 2-Oxocarboxylic acid metabolism
    BMQ_3052 (citA)
   01230 Biosynthesis of amino acids
    BMQ_3052 (citA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_3052 (citA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMQ_3052 (citA)
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BMQ_3052 (citA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3026444..3027547)
Genome map
AA seq 367 aa AA seqDB search
MTYVKGLEGIIAAETKVGHVDGEKGQLIYRGYWAKDLAINYSFEEVSYLIWNGTLPNHDE
LKAFKQKMVTHRTLPANIVALMDCLPKDTEVMSALRTCISALGDPSYSWPPTKEQALAIT
AVTPTIIAYWYRKMNDLEVVEPNEHLDHVANYLYMINGEIPDQSLVTALNAYFVLTIEHG
MNASTFSSRVISSTESDMVSAICGAIGAMKGPLHGGAPSGVITMFDEIGSEENIEPWVRK
KLDNKEKIMGFGHRVYRTHDPRAEALKEVSKQISGDNGLFDLIVKIEDKTIELLNEYKPG
RGIYTNVEYFAAAVMKAVELPSELFTPTFTASRVVGWTAHVVEQSENNRIYRPQSAYIGY
TPVEQNQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgttaaaggactagaaggaatcattgcagctgaaacaaaagtagggcatgtt
gatggagagaaaggtcagctgatttatcgcggatattgggcaaaagatttggcgatcaat
tattcttttgaagaagtttcttatttaatttggaacggcacgctgccaaatcatgatgag
ttaaaagcatttaaacaaaaaatggtgactcatcgtacgcttccagctaatattgttgcg
ttaatggactgtttgccaaaagatacagaagtgatgagcgcgcttcgcacatgtatctca
gcattaggagacccttcatacagctggcctccgacaaaagagcaggcgcttgcgattaca
gcggtaacacctaccattattgcctattggtatcgtaaaatgaatgatttagaagtagta
gaacctaacgagcatttggatcatgtagcaaactatttatatatgattaacggggaaatt
ccagatcaaagtttggttactgcgctgaacgcatattttgttttgacaattgaacatggg
atgaacgcctcaaccttctcatcacgcgttatttcatctaccgaatctgacatggtttca
gctatttgcggagcaattggcgcgatgaaaggtccgcttcacggaggagctccttctggt
gttattaccatgtttgatgaaattggaagtgaagagaatattgagccttgggttcgtaaa
aaattagataataaagagaaaattatgggatttggtcatcgcgtttatcgtacacatgac
ccaagagcagaagcattaaaagaagtatcgaaacaaatctcaggagacaacgggctattt
gatttaattgttaaaattgaagataaaaccattgaattactcaatgaatacaagccgggt
cgaggcatttataccaatgtagaatatttcgctgcagcggttatgaaagcggttgagctt
ccgtctgaactattcacaccaaccttcacagcaagccgtgtagttggctggacagctcat
gtcgtagagcagtcagaaaataatcgtatttaccgacctcagtctgcgtatataggttat
acgccagttgaacaaaatcaataa

DBGET integrated database retrieval system