KEGG   Bacillus megaterium QM B1551: BMQ_3237Help
Entry
BMQ_3237          CDS       T01208                                 

Definition
Riboflavin synthase/Ferredoxin reductase FAD binding domain-containing protein (EC:1.-.-.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BMQ_3237
  Amino acid metabolism
   00380 Tryptophan metabolism
    BMQ_3237
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMQ_3237
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BMQ_3237
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BMQ_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3172577..3175726)
Genome map
AA seq 1049 aa AA seqDB search
MPIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIK
EACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM
VDIAVQLIQKWERLNTDEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR
ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIITDRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV
DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ
LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK
HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHN
TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH
PPDNAKEFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAE
RGEADASDDFEGTYEEWREHMWSDLAAYFNLDIENSEENASTLSLQFVDSASDMPLAKMH
RAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDHLGVIPRNYEGIVNRVATRFG
LDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE
LEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE
KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLI
MVGPGTGVAPFRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQKELENAQNEGIIT
LHTAFSRVPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAE
VHQVSEADARLWLQQLEEKGRYAKDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaaagaaatgcctcagccaaaaacatttggagaacttaaaaacttaccgtta
ttaaacacagataaaccgattcaaactttgatgaaaattgcggatgaattaggagaaatc
tttaaatttgaagcgcctggccgcgtgacgcgctacttatcgagtcagcgtctaatcaaa
gaagcatgcgatgaatcacgctttgataaaaacttaagtcaagcgcttaaatttgtgcgt
gattttgcaggagacggtttatttacaagctggacccacgaaaaaaactggaaaaaagcc
cataacatcttgcttccaagcttcagccagcaagcaatgaaaggctatcatgcgatgatg
gtagatatcgctgtgcagcttattcaaaagtgggagcgtctaaatacagatgagcatatt
gaagtaccggaagatatgacgcgtttaacgcttgatacaatcggtctttgcggcttcaac
tatcgctttaacagcttttaccgagatcagccgcatccgtttattacaagtatggttcgt
gcactagatgaagcaatgaacaagttgcagcgagcaaatccagatgatccagcttacgat
gaaaataagcgccagtttcaagaagatatcaaagtgatgaacgacctagtagataaaatt
attacagaccgcaaagcaagcggtgaacaaagcgatgatttgttaacgcatatgctaaac
ggaaaagatccagaaacaggtgagccgcttgatgacgagaacattcgctatcaaattatt
acgttcttaattgcgggacatgaaacaacaagcggtcttttatcatttgcgctgtatttc
ttagtgaaaaatccacatgtattacaaaaagcagcagaagaagcagcacgagttttagta
gatcctgtgccaagctacaaacaagtcaaacagcttaaatatgtgggcatggtcttaaat
gaagcgctgcgcttatggccaacggctcctgcgttttccctatatgcaaaagaagatacg
gtgcttggaggagagtatcctttagaaaaaggtgatgaactgatggttctgattcctcag
cttcaccgtgataaaacaatttggggagacgatgtagaggagtttcgcccagagcgtttt
gaaaacccaagcgcgattccacagcatgcgtttaaaccatttggaaacgggcagcgtgcg
tgtatcggtcagcagttcgctcttcatgaagcaacgcttgtacttggtatgatgctaaaa
cactttgattttgaagatcatacaaactacgagctggatattaaagaaactttaacgtta
aaacctgaaggctttgttgtaaaagcaaaatcgaaacaaattccgcttggcggcattcct
tcaccaagccgagagcagtcagctaaaaaagagcgcaaaaccgtagaaaacgctcataat
acgccgcttcttgtgctatacggttcaaatatgggaacagccgaaggaacggcgcgtgat
ttagcggatattgcgatgagcaaaggattcgcaccgcaagtcgcaacgcttgattcccac
gcaggaaaccttccgcgtgaaggagctgttttaattgtaacggcttcttataacggtcat
cctcctgataacgcaaaggaatttgttgactggttagaccaagcgtctgctgatgaagta
aaaggcgtgcgctactccgtatttggatgcggtgataaaaactgggcgacaacgtatcaa
aaagtgcctgcttttattgatgaaactcttgccgctaaaggggcagaaaacatagctgaa
cgcggtgaagcagatgcaagcgacgactttgaaggcacgtacgaagaatggcgtgaacac
atgtggagtgacttagcagcctactttaacttagacattgaaaacagcgaagaaaatgcg
tctacgctttcccttcaatttgtcgacagcgcttcggacatgccgcttgcgaaaatgcac
cgtgcgttttcagcaaacgtcgtagcaagcaaagagcttcaaaagccaggcagtgcacga
agcacgcgtcatcttgaaattgaacttccaaaagaagcttcttatcaagaaggagatcat
ttaggtgttattcctcgcaactatgaaggaatagtaaatcgtgtagcaacaagattcggt
ctagatgcatcacagcaaatccgtttggaagctgaagaagaaaaattagctcatttgcca
ctcggtaaaacagtatcagtagaagagcttctgcaatacgtggagcttcaagatcctgtt
acgcgcacgcagcttcgcgcaatggctgctaaaacagtctgcccgccgcataaagtagag
cttgaagtcttgcttgaaaagcaggcgtacaaagaacaagtgctggcaaaacgtttaaca
atgcttgaactgcttgaaaaatatccggcgtgtgaaatggaattcagcgaatttatcgca
cttcttccaagcatgcgtccgcgctattactcaatttcttcatcacctcgtgtcgatgaa
aaacaagcaagcatcacggtcagcgttgtttcaggagaagcgtggagcggatacggagaa
tacaaaggaattgcatcgaactatcttgccaatctgcaagaaggagatacgattacgtgc
tttgtttccacaccgcagtcaggatttacgctgccaaaaggccctgaaacaccacttatc
atggtaggaccgggaacaggcgtcgcgccgtttagaggctttgtgcaggctcgcaagcag
ttaaaagaacaaggacagtcgcttggagaagcgcatttatactttggctgccgttcacct
catgaagattatctgtatcaaaaagagcttgaaaacgcccaaaatgaaggcatcattacg
cttcataccgctttttctcgcgtaccaaatcagccgaaaacatacgttcagcacgtgatg
gaacaagacggcaagaaattgattgaacttcttgaccaaggagcgcacttctatatttgc
ggagacggaagccaaatggcacctgacgttgaagcaacgcttatgaaaagctatgctgaa
gttcaccaagtgagtgaagcagacgctcgcttatggctgcagcagctagaagaaaagggc
cgatacgcaaaagacgtgtgggctgggtaa

DBGET integrated database retrieval system