KEGG   Bacillus megaterium QM B1551: BMQ_3385Help
Entry
BMQ_3385          CDS       T01208                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMQ_3385
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BMQ_3385
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BMQ_3385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3295574..3296467
Genome map
AA seq 297 aa AA seqDB search
MSNKYRVRKNVLRLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAH
MSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQLQDPSQSQIWSADFMGGNGNP
KKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLDALKITQYDTP
PWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIVHRNQNYQPMKSGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaagtacagagttagaaaaaacgtattacggcttaccgacacggaaaaaaga
gattttgttcgtaccgtgctaatactaaaggaaaaagggatatatgaccgctatatagcc
tggcatggtgcagcaggtaaatttcatactcctccgggcagcgatcgaaatgcagcacat
atgagttctgcttttttgccgtggcatcgtgaataccttttacgattcgaacgtgacctt
caatcaatcaatccagaagtaacccttccttattgggaatgggaaacggacgcacagctg
caggatccctcacagtcacaaatttggagtgcagattttatgggaggaaacggaaatccc
aaaaaagattttatcgtcgataccgggccatttgcagctgggcgctggacgacgatcgat
gaacaaggaaatccttctggagggctaaaacgtaattttggagcaactaaagaggcacct
acattgcctactcgagatgatgtgctcgatgctttaaaaataactcaatatgacacgccg
ccttgggatatgaccagccaaaacagctttcgtaatcagcttgaaggatttattaacggg
ccacagcttcacaatcgcgtacaccgttgggttggcggacagatgggcgttgtccctact
gctccgaatgatcctgtcttctttttacaccacgcaaatgtggatcgtatttgggctgta
tggcaaattgttcatcgcaatcaaaactatcagccgatgaaaagcgggccatttggtcaa
aactttagagatccgatgtatccttggaatacaacccctgaagacgttatgaaccatcga
aagcttgggtacgtatacgatatagaattaagaaaatcaaaacgttcatcataa

DBGET integrated database retrieval system