KEGG   Bacillus megaterium QM B1551: BMQ_3385Help
Entry
BMQ_3385          CDS       T01208                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bmq00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bmq00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3295574..3296467
Genome map
AA seq 297 aa AA seqDB search
MSNKYRVRKNVLRLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAH
MSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQLQDPSQSQIWSADFMGGNGNP
KKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLDALKITQYDTP
PWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIVHRNQNYQPMKSGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaagtacagagttagaaaaaacgtattacggcttaccgacacggaaaaaaga
gattttgttcgtaccgtgctaatactaaaggaaaaagggatatatgaccgctatatagcc
tggcatggtgcagcaggtaaatttcatactcctccgggcagcgatcgaaatgcagcacat
atgagttctgcttttttgccgtggcatcgtgaataccttttacgattcgaacgtgacctt
caatcaatcaatccagaagtaacccttccttattgggaatgggaaacggacgcacagctg
caggatccctcacagtcacaaatttggagtgcagattttatgggaggaaacggaaatccc
aaaaaagattttatcgtcgataccgggccatttgcagctgggcgctggacgacgatcgat
gaacaaggaaatccttctggagggctaaaacgtaattttggagcaactaaagaggcacct
acattgcctactcgagatgatgtgctcgatgctttaaaaataactcaatatgacacgccg
ccttgggatatgaccagccaaaacagctttcgtaatcagcttgaaggatttattaacggg
ccacagcttcacaatcgcgtacaccgttgggttggcggacagatgggcgttgtccctact
gctccgaatgatcctgtcttctttttacaccacgcaaatgtggatcgtatttgggctgta
tggcaaattgttcatcgcaatcaaaactatcagccgatgaaaagcgggccatttggtcaa
aactttagagatccgatgtatccttggaatacaacccctgaagacgttatgaaccatcga
aagcttgggtacgtatacgatatagaattaagaaaatcaaaacgttcatcataa

DBGET integrated database retrieval system