KEGG   Bacillus megaterium QM B1551: BMQ_3409Help
Entry
BMQ_3409          CDS       T01208                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMQ_3409 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_3409 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMQ_3409 (thrC)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMQ_3409 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3319779..3320993)
Genome map
AA seq 404 aa AA seqDB search
MPFSYVSHLYCPKCKNEYSPKEKHQLCECGSPLLVAYDLERLKDNLSPEDVQSREPNLWR
YHELLPVEDPENVVSLGEGMTPLIKMPKLGKEMNIQNLYMKDEGIIPTGSFKARGAAVGV
SKAKELGVEQLAMPTNGNAGAAWSLYSSRADIKATVVMPKDAPVITRNECAVAGADLYLV
DGLISDAGKIVGEAIKAWGLYDASTLKEPYRIEGKKTMGLEIAEQFSWNLPDVILYPTGG
GVGLIGIYKALNELKELGWIKGDLPRLVAVQAENCAPIVKAWNERKQESEFWPDSSTIAF
GINVPKAIGDFLVLEAVYNTNGCAIAVDEDKIVEEQKKVAQLEGSFICPEGAATFLAARR
LREEGWIKENETVVALNTGLGVKYPNTVDIEVPILERNGSLTKK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttagttatgtttctcacttatattgtcctaaatgtaaaaatgaatatagtcca
aaagaaaaacatcaattatgtgaatgtggctcacctttattagtagcgtatgatttagag
agactgaaagacaatctaagtccagaagatgtccaaagcagagaaccaaatctatggaga
tatcatgaactgcttccagtagaagatccagaaaacgtcgtttccttaggagaagggatg
actccgcttataaaaatgcctaagctaggtaaagaaatgaacattcaaaacttatatatg
aaagatgaaggcattattccaacgggatcatttaaagctagaggcgccgctgtaggtgtg
tcaaaagcaaaagaacttggcgttgaacagttagcgatgcctacaaatggcaacgcagga
gctgcttggtcgctttattcgtcacgcgctgacataaaagcaaccgtcgtgatgccaaaa
gatgcgcctgttattacacgaaatgagtgtgctgtcgctggagctgacctttacctagtc
gatggactcatcagcgatgcgggtaaaattgtcggtgaagctattaaagcctggggtctt
tatgacgcttctacgcttaaagagccgtatcgaattgaaggtaaaaaaacaatgggcctg
gaaattgctgaacagttttcttggaatcttcctgatgtaattttatatccaacaggagga
ggcgttggattaatcggaatctacaaagcgttaaatgaattaaaagagcttggctggatt
aaaggtgatcttcctcgtttagttgcggtacaagctgaaaactgcgcgcctattgtaaaa
gcatggaatgagagaaaacaagaatctgaattttggccggattcttcaaccattgccttt
ggtatcaacgtaccaaaagcaatcggggactttcttgttttagaggccgtatacaataca
aatggatgcgcgattgcggtggacgaagataagattgtggaggaacaaaaaaaggttgcg
cagcttgaaggttcgttcatttgtcctgaaggtgctgctacattcttagctgcacgccgt
ttaagagaagaaggctggattaaagaaaacgaaacggttgttgctttaaatacagggctt
ggagttaaatatccaaacacggtagatattgaagtacctattttagagcgaaatggcagc
cttactaaaaaataa

DBGET integrated database retrieval system