KEGG   Bacillus megaterium QM B1551: BMQ_3588Help
Entry
BMQ_3588          CDS       T01208                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMQ_3588 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMQ_3588 (mhpF)
   00650 Butanoate metabolism
    BMQ_3588 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BMQ_3588 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMQ_3588 (mhpF)
   00622 Xylene degradation
    BMQ_3588 (mhpF)
   00621 Dioxin degradation
    BMQ_3588 (mhpF)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BMQ_3588 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3472483..3473400)
Genome map
AA seq 305 aa AA seqDB search
MEKVKAAIIGSGNIGTDLMYKLQRSEFIELTAVLGIDPDSDGLKRAREAGYQTYSNGIKA
LAENPDLAEIVFDATSAKAHVRHSKILKDLGKMVIDLTPAAKGPFVCPPVNLGENLESEN
VNMITCGGQATIPIIYAINQVADVTYGEIVATISSLSAGPGTRANIDEFTVTTRKAIEKV
GGADCGKAIILLNPADPPILMRDTIYCKVKNVNKEAIQKAIKDMVKKVQEYVPGYNLKQE
PLFDSDQVTVFLEVTGAGDYFPSYAGNLDIMTAAAAKVAEDYARYKIEESLYGGIKKERA
ITNET
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaagtaaaagccgcaattattggctcaggaaatattgggaccgatttgatgtat
aagcttcagcgcagcgaatttatcgagttaacagctgttcttggaattgatccggattca
gatggtctaaaaagagcgagagaagcaggatatcaaacatacagcaatggaataaaagcc
cttgctgaaaatccagatctggcagaaattgtgtttgatgctacatcggctaaggctcac
gttagacattcaaagattttaaaagacttaggaaaaatggttatcgacttaactcctgct
gccaaaggaccttttgtgtgtcctcctgttaaccttggagaaaatcttgaatcagaaaat
gtaaacatgattacatgcggcggtcaagcaacgattcctatcatttatgcaatcaaccaa
gttgcagatgtaacatatggagaaattgtggctactatttctagcctaagcgctggacca
ggaacacgagcaaatattgatgagtttactgttaccacaagaaaagctattgaaaaggta
ggaggtgcagactgcggaaaagctattattctcttaaatccggctgatccacctatctta
atgcgcgatacaatttattgtaaagtgaaaaatgtgaataaagaagctattcaaaaggct
atcaaggatatggtcaaaaaagtacaagaatatgtaccaggctataatttaaagcaagaa
ccattatttgatagtgatcaagtaacagtctttttagaggtaactggagctggagattat
tttccttcttatgccggtaacttagatattatgacggctgctgcagcgaaggttgcggaa
gattatgcccgctataaaatcgaagagagcttatatggaggaataaagaaagagagggct
ataacgaatgaaacgtaa

DBGET integrated database retrieval system