KEGG   Bacillus megaterium QM B1551: BMQ_3588Help
Entry
BMQ_3588          CDS       T01208                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmq00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmq00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bmq00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bmq00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bmq00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3472483..3473400)
Genome map
AA seq 305 aa AA seqDB search
MEKVKAAIIGSGNIGTDLMYKLQRSEFIELTAVLGIDPDSDGLKRAREAGYQTYSNGIKA
LAENPDLAEIVFDATSAKAHVRHSKILKDLGKMVIDLTPAAKGPFVCPPVNLGENLESEN
VNMITCGGQATIPIIYAINQVADVTYGEIVATISSLSAGPGTRANIDEFTVTTRKAIEKV
GGADCGKAIILLNPADPPILMRDTIYCKVKNVNKEAIQKAIKDMVKKVQEYVPGYNLKQE
PLFDSDQVTVFLEVTGAGDYFPSYAGNLDIMTAAAAKVAEDYARYKIEESLYGGIKKERA
ITNET
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaagtaaaagccgcaattattggctcaggaaatattgggaccgatttgatgtat
aagcttcagcgcagcgaatttatcgagttaacagctgttcttggaattgatccggattca
gatggtctaaaaagagcgagagaagcaggatatcaaacatacagcaatggaataaaagcc
cttgctgaaaatccagatctggcagaaattgtgtttgatgctacatcggctaaggctcac
gttagacattcaaagattttaaaagacttaggaaaaatggttatcgacttaactcctgct
gccaaaggaccttttgtgtgtcctcctgttaaccttggagaaaatcttgaatcagaaaat
gtaaacatgattacatgcggcggtcaagcaacgattcctatcatttatgcaatcaaccaa
gttgcagatgtaacatatggagaaattgtggctactatttctagcctaagcgctggacca
ggaacacgagcaaatattgatgagtttactgttaccacaagaaaagctattgaaaaggta
ggaggtgcagactgcggaaaagctattattctcttaaatccggctgatccacctatctta
atgcgcgatacaatttattgtaaagtgaaaaatgtgaataaagaagctattcaaaaggct
atcaaggatatggtcaaaaaagtacaagaatatgtaccaggctataatttaaagcaagaa
ccattatttgatagtgatcaagtaacagtctttttagaggtaactggagctggagattat
tttccttcttatgccggtaacttagatattatgacggctgctgcagcgaaggttgcggaa
gattatgcccgctataaaatcgaagagagcttatatggaggaataaagaaagagagggct
ataacgaatgaaacgtaa

DBGET integrated database retrieval system