KEGG   Bacillus megaterium QM B1551: BMQ_3992Help
Entry
BMQ_3992          CDS       T01208                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00030  Pentose phosphate pathway
bmq00051  Fructose and mannose metabolism
bmq00052  Galactose metabolism
bmq00680  Methane metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
bmq03018  RNA degradation
Module
bmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmq_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_3992 (pfkA)
   00030 Pentose phosphate pathway
    BMQ_3992 (pfkA)
   00051 Fructose and mannose metabolism
    BMQ_3992 (pfkA)
   00052 Galactose metabolism
    BMQ_3992 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BMQ_3992 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMQ_3992 (pfkA)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMQ_3992 (pfkA)
Protein phosphatases and associated proteins [BR:bmq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BMQ_3992 (pfkA)
Messenger RNA biogenesis [BR:bmq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMQ_3992 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADE71004
UniProt: D5DPB6
Position
complement(3833819..3834778)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNPAVRAVVRKAIHEGMEVYGIYQGYQGLIEGNIKKLEVGDVGDI
IQRGGTMLYSARCPEFKTEEGRLKGIENLKKHGIEGLVVIGGDGSYMGAVKLTELGFPCI
GIPGTIDNDIPGTDFTLGFDTALHTVIDAIDKIRDTATSHERTFIIEVMGRNAGDIALWS
GLAGGAETILIPEAKDEFQEMVDRLRKGQERGKKHSIIVVAEGVANGNEVAKQLHEAAGI
ETRVTVLGHIQRGGSPTAQDRVLGSRFGGRAVELLLEGKGGRAIGIRKNEIVDYDIMEIL
GEPHHINADMYRLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggtgtattaacaagcggcggagattctccaggtatgaatcctgcggtt
cgtgctgttgtgcgtaaagcaattcatgaaggtatggaagtttacggtatctatcaagga
tatcaagggttaatagaaggaaatattaaaaagctagaagttggagatgttggtgacatc
attcaacgcggtggaactatgctttattctgcaagatgtccagaattcaaaacagaagaa
gggcgtttaaaaggtattgaaaaccttaagaagcacggtattgaaggcttagtagttatt
ggtggagacggatcatatatgggagctgtaaaactaacagagcttggtttcccttgtatc
ggtatcccaggaacaattgataacgacattccaggaacagattttacattaggatttgat
acggctcttcatacggttatcgatgcaattgataaaatccgtgacacggcgacttctcat
gaacgtacgtttattattgaagttatgggtcgtaatgcaggagacattgctctttggtca
ggtcttgctggcggtgcggaaacaatccttatcccagaagcaaaagatgagttccaagaa
atggttgatcgtttgagaaaaggccaagagcgcggtaaaaagcacagcattattgtagta
gctgaaggtgtagccaatggtaatgaagtggcgaagcagcttcatgaagctgcaggtatt
gaaacgcgtgtaacagtattaggacacattcagcgcggtggttccccaactgctcaagat
cgtgtgctaggaagccgtttcggcggtcgtgcagtcgagcttctgctagaaggtaaaggc
ggccgtgcaatcggtatccgtaaaaatgaaattgtagattatgatattatggaaatttta
ggtgaacctcaccatatcaatgctgatatgtaccgtttatctaaagagctttcaatctaa

DBGET integrated database retrieval system