KEGG   Bacillus megaterium QM B1551: BMQ_3992Help
Entry
BMQ_3992          CDS       T01208                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_3992 (pfkA)
   01230 Biosynthesis of amino acids
    BMQ_3992 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_3992 (pfkA)
   00030 Pentose phosphate pathway
    BMQ_3992 (pfkA)
   00051 Fructose and mannose metabolism
    BMQ_3992 (pfkA)
   00052 Galactose metabolism
    BMQ_3992 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BMQ_3992 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMQ_3992 (pfkA)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMQ_3992 (pfkA)
Protein phosphatases and associated proteins [BR:bmq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BMQ_3992 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3833819..3834778)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNPAVRAVVRKAIHEGMEVYGIYQGYQGLIEGNIKKLEVGDVGDI
IQRGGTMLYSARCPEFKTEEGRLKGIENLKKHGIEGLVVIGGDGSYMGAVKLTELGFPCI
GIPGTIDNDIPGTDFTLGFDTALHTVIDAIDKIRDTATSHERTFIIEVMGRNAGDIALWS
GLAGGAETILIPEAKDEFQEMVDRLRKGQERGKKHSIIVVAEGVANGNEVAKQLHEAAGI
ETRVTVLGHIQRGGSPTAQDRVLGSRFGGRAVELLLEGKGGRAIGIRKNEIVDYDIMEIL
GEPHHINADMYRLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggtgtattaacaagcggcggagattctccaggtatgaatcctgcggtt
cgtgctgttgtgcgtaaagcaattcatgaaggtatggaagtttacggtatctatcaagga
tatcaagggttaatagaaggaaatattaaaaagctagaagttggagatgttggtgacatc
attcaacgcggtggaactatgctttattctgcaagatgtccagaattcaaaacagaagaa
gggcgtttaaaaggtattgaaaaccttaagaagcacggtattgaaggcttagtagttatt
ggtggagacggatcatatatgggagctgtaaaactaacagagcttggtttcccttgtatc
ggtatcccaggaacaattgataacgacattccaggaacagattttacattaggatttgat
acggctcttcatacggttatcgatgcaattgataaaatccgtgacacggcgacttctcat
gaacgtacgtttattattgaagttatgggtcgtaatgcaggagacattgctctttggtca
ggtcttgctggcggtgcggaaacaatccttatcccagaagcaaaagatgagttccaagaa
atggttgatcgtttgagaaaaggccaagagcgcggtaaaaagcacagcattattgtagta
gctgaaggtgtagccaatggtaatgaagtggcgaagcagcttcatgaagctgcaggtatt
gaaacgcgtgtaacagtattaggacacattcagcgcggtggttccccaactgctcaagat
cgtgtgctaggaagccgtttcggcggtcgtgcagtcgagcttctgctagaaggtaaaggc
ggccgtgcaatcggtatccgtaaaaatgaaattgtagattatgatattatggaaatttta
ggtgaacctcaccatatcaatgctgatatgtaccgtttatctaaagagctttcaatctaa

DBGET integrated database retrieval system