KEGG   Bacillus megaterium QM B1551: BMQ_4171Help
Entry
BMQ_4171          CDS       T01208                                 

Gene name
cheB
Definition
chemotactic two-component response regulator-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmq02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bmq02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4018211..4019254)
Genome map
AA seq 347 aa AA seqDB search
MNEIKVLIVDDSAFMRKLIGDFLACDSRFHVVGTARNGEEGLKKALELSPDIVTLDIEMP
KMNGLDMLKQLMRVKPLPVVMLSSTTIEGAENTLTAMQYGAVDFVAKPSGAISLDLHKVK
DELISKLLLASKANISSSSHQHAQNSSVYNLPMGTKVNKMICIGTSTGGPRALQEVLSTV
SKDINAPIFIVQHMPPNFTKSLAARLNQLSDIEVKEAKDNEIVRSGCAYIAPGGFHMTVV
EKKGQLSICLDTSSPVKGHRPSVDRLFQSISKISGYQALAIVLTGMGADGTEGVIELKKN
KDVLVLAESEETAVIYGMPKSAVSTKLVDYIEPLRNVGSFISRYAQK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaataaaggtgcttattgtagatgattctgcatttatgcgaaagctaatcggc
gattttttagcatgtgacagtcgttttcacgttgtgggtaccgcacgtaatggtgaagaa
gggttgaaaaaagcgctcgagctgtcgccagacattgtgacacttgatattgaaatgccc
aaaatgaatggcttagatatgttaaaacagctcatgcgcgtgaagccccttcctgttgtc
atgttatcgagtacaacaatagaaggtgctgaaaatacgctgaccgctatgcagtacggc
gcagttgattttgttgctaaaccttcgggagctatttcgctggacttacataaagtgaaa
gatgagcttatctctaaactattgcttgctagtaaagccaacatatcttcaagcagtcat
cagcacgcgcaaaacagcagtgtatataacctcccgatggggacgaaagtgaacaaaatg
atttgtattggcacttctactggaggaccgcgtgcgctgcaagaagtattatcaactgtt
tcaaaagacataaacgcacctatttttattgtgcagcatatgccgccaaattttacaaaa
tcattagcagctagattaaatcagctgtctgatattgaagtgaaagaagcaaaagacaat
gaaatcgttcgctcaggatgtgcgtatattgcgcctggaggttttcatatgacggttgta
gagaaaaaaggacagctcagcatttgtttagatacttcttcacctgtaaagggacatcgc
ccctcagtggatcgtttgtttcagtcgattagtaaaatttcaggttatcaagcgcttgcc
attgtgttgacgggaatgggggcggatggaacggaaggcgtgattgagttaaagaaaaat
aaagatgtgcttgtactagctgaatctgaggaaactgctgtcatttatgggatgcccaaa
tcagccgtttctacaaaacttgttgattatattgaaccgctgagaaacgttggaagcttt
atttctcgctacgcacagaaatag

DBGET integrated database retrieval system