KEGG   Bacillus megaterium QM B1551: BMQ_4318Help
Entry
BMQ_4318          CDS       T01208                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00260  Glycine, serine and threonine metabolism
bmq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01130  Biosynthesis of antibiotics
bmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_4318 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMQ_4318 (trpA)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMQ_4318 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Pterin_bind PcrB
Motif
Other DBs
NCBI-ProteinID: ADE71328
UniProt: D5DRE9
Position
complement(4165629..4166444)
Genome map
AA seq 271 aa AA seqDB search
MNTFEARLPKHETLFIPFITAGDPHEDATVDIALSLQKQGASILELGVPYSDPLADGPII
QEASKRALSGGMSISKAIKLVSVMRKKGVKIPVILFTYFNPVLQLGLESFFALMRENEID
GVLIPDLPYEESGRIRELAAENEVAYISMVAPTSKERIQKIAADATGFLYCVSSLGVTGV
RSTLPADIGTFLEDVKAAASIPVAVGFGISTSEQVEVLKEHSDGIVIGSAIVNKIGQLEQ
VLLNKDTRRDGLNQIEEYVASIVSPIQKCEV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtttgaagcgagactacctaaacatgaaacattgtttattccatttattaca
gcaggagatcctcatgaagatgcaacggtggatattgctttgtctttgcaaaagcaaggt
gcttctattttagagctgggcgtaccatattccgaccctttagcagatggtccaattatt
caagaggcgtccaaaagagctttatctggcggtatgtctatttcaaaagcgattaagctt
gtatcggtgatgagaaaaaaaggtgtgaaaataccggtaattctctttacctattttaat
cctgtgttacaattaggtttagaatcctttttcgcgttaatgcgagaaaatgaaatagat
ggagtgctaattccggatttaccgtacgaagagagtggccgtatccgggagcttgccgct
gaaaatgaagttgcgtacatttcgatggttgctcctacatctaaagagcgtattcaaaaa
atcgctgcagatgcaacgggcttcttatactgcgtgtcgtctttaggcgttactggggtt
cgctctacgttgccagctgatattggcacctttttagaagatgtgaaagcagcagcttct
ataccggttgccgtcggttttgggatttcaacaagtgaacaagtagaggtgttaaaagaa
catagcgacggcattgtaattggaagtgcaattgttaataaaattggccagcttgaacaa
gttcttttaaataaggatacacgccgagacggattaaatcaaattgaggagtatgttgca
tccatcgtttcgcctatacaaaaatgcgaggtgtaa

DBGET integrated database retrieval system