KEGG   Bacillus megaterium QM B1551: BMQ_4319Help
Entry
BMQ_4319          CDS       T01208                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMQ_4319 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_4319 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMQ_4319 (trpB)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMQ_4319 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4166431..4167645)
Genome map
AA seq 404 aa AA seqDB search
MTYNHPDEFGRFGEFGGKYVPETLMKPLEEVEAALNQAMKDPAFKDEYLSLLVNYSGRPT
ALTYADNITETLGGAKIYLKREDLNHTGAHKINNAIGQILLAKRMGKTKIIAETGAGQHG
VATATVAAKFGMECKVFMGEEDIERQALNVFRMKLLGAEVIPATSGTKTLKDATNEAIRY
WVQHCEDHFYLIGSAIGPHPYPKMVRDFQKIIGEEAKEQFTAVEGKLPNAVVACVGGGSN
AIGMFYDFIKEENVRLIGVEAGGKGLNTALHAAKMAKGTKGVIHGTLTYLLQDENGQITE
PYSISAGLDYPGIGPEHSHLSSIGRVEYESVTDDESIEALQLLAKTEGIIPAIESAHALA
KAFELAKSMTKEETILICLSGRGDKDVHTLVNLLEGKEEEHEYV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaatcatcctgatgaatttggccgctttggtgaatttggcggaaaatacgta
cctgaaacattaatgaaaccacttgaagaagtagaagcagctttgaatcaagcaatgaaa
gatccagcatttaaagatgagtatctatccttacttgttaactactctgggcgaccaaca
gctttaacatatgctgataatattaccgaaacgctcggcggggcaaaaatttatttaaag
cgtgaagatttaaatcatacgggtgctcacaaaatcaataatgccattggacagatttta
cttgctaaacggatgggaaaaacaaaaattattgctgaaacaggagcgggtcagcacggg
gtagccacagctacagtagctgcaaagttcggaatggaatgtaaagtattcatgggagaa
gaagatattgaacgtcaggcgttgaacgtttttcgcatgaagcttctaggagcggaagtc
attcccgcaacttctggaacaaaaacgctaaaagatgcaacaaatgaagcaattcgctac
tgggttcaacattgtgaagatcatttttacttaattggttcggctattggaccgcaccct
tatcctaaaatggttcgagatttccaaaaaattattggagaagaagcaaaagaacagttt
acagcggtagaaggcaaacttccgaatgctgtcgtggcatgcgtcggaggcggcagtaat
gcaatcggaatgttttatgattttattaaagaagaaaatgtacgcttgatcggcgtagaa
gcaggagggaaaggactaaatacagcccttcatgctgctaaaatggctaaaggcacaaaa
ggtgttattcacggaacgctcacgtatttacttcaagatgaaaatggtcagattacagag
ccttattctatttcagcaggtttggattatccaggtatcggtccagagcattctcacctt
tcatctattggaagagtggaatacgaaagtgtaacggatgatgagtcaatcgaagctctt
cagctgctggcgaaaacagagggaatcatcccggctattgagtccgcccatgcgctggca
aaagcatttgaactggctaaaagcatgacgaaagaagaaacaattttaatttgcttgtca
ggtcgaggagataaggacgttcatacattagtaaacttgctagaagggaaggaagaagaa
catgaatacgtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system