KEGG   Bacillus megaterium QM B1551: BMQ_4501Help
Entry
BMQ_4501          CDS       T01208                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00052  Galactose metabolism
bmq00500  Starch and sucrose metabolism
bmq00520  Amino sugar and nucleotide sugar metabolism
bmq00521  Streptomycin biosynthesis
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_4501 (glk)
   00052 Galactose metabolism
    BMQ_4501 (glk)
   00500 Starch and sucrose metabolism
    BMQ_4501 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_4501 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMQ_4501 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMQ_4501 (glk)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMQ_4501 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADE71510
UniProt: D5DSB2
Position
complement(4334953..4335921)
Genome map
AA seq 322 aa AA seqDB search
MDDKWLVGVDLGGTTIKMAFINHYGEIIHKWEINTDVSEQGRKIPTDIAKAIDKKLNDLG
EVKSRLVGIGIGAPGPVNFANGSIEVAVNLGWEKFPIKDILEVETSLPVVVDNDANIAAI
GEMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAGEIGHITSIPEGGAPCNCG
KTGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVTSKDVFDAARSKDELAMHV
VDKVAFHLGLALANSANALNPEKIVLGGGVSRAGEVLLAPVRDYFKRFAFPRVAQGAELA
IATLGNDAGIIGGAWLVKSYFE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaatggttagttggagttgatttaggcggtacaacaataaaaatggccttt
attaatcattatggagaaatcattcacaagtgggaaattaatacggatgtgagcgagcaa
ggccgtaaaattccaacagatattgcaaaagcaattgataaaaagttaaacgatcttgga
gaagtaaaatcaaggttagtaggaattggtattggtgcaccggggcctgtcaactttgca
aacggttcgattgaagtagctgtcaatttaggttgggaaaaattccctatcaaagatatc
ttggaagtagaaacttctcttcctgttgtagtagacaatgatgcaaacattgcagcgatt
ggagaaatgtggaagggtgctggagacggagcaaaagatttactttgcgttacacttggc
acaggcgttggcggtggcgtcattgcaaacggtgaaattgtacaaggcgtaaatggagcc
gctggtgagatcgggcacattacttctattcctgaaggcggggcaccgtgtaactgcggc
aaaaccggctgtttagaaacaattgcttcagcaactggaattgtacgtttaacgatggaa
gaattaacggaaacggacaaaccaagtgagcttcgcacagtgttagaacaaaatggacaa
gttacatctaaagatgtatttgatgcagctcgttcaaaagacgagttagctatgcatgtt
gtagataaagttgcctttcatttaggtctagcactagcaaactctgctaatgcattaaac
cctgagaagatcgttctaggcggcggtgtgtctcgtgcaggcgaggtattacttgcaccg
gtaagagattatttcaaacgttttgcatttcctcgcgtagcgcaaggtgctgaactagca
atcgctactttaggaaacgatgcgggaattattggaggagcttggttagttaaatcttat
tttgaataa

DBGET integrated database retrieval system