KEGG   Bacillus megaterium QM B1551: BMQ_4516Help
Entry
BMQ_4516          CDS       T01208                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Brite
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMQ_4516 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADE71525
UniProt: D5DSC7
Position
complement(4351119..4351727)
Genome map
AA seq 202 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAAVEGKADLESKSIEELISN
LDAVPEDIRTAVRNNGGGHANHSLFWTILCPNGGGAPTGELADAIASKFGSFDQFKEEFA
NAAKTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFFNVVKWDEVAKRYDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaattaccagaactaccttatgcatacgatgcactggaaccacatatcgac
aaagaaacaatgaatattcaccacacaaaacatcacaacacatatgttacaaatctaaac
gctgctgttgaaggcaaagcggatttagaaagcaaaagtattgaagagttaatttcaaac
ttagatgctgttcctgaagatatccgtacagcagtacgcaataacggtggcggtcatgcg
aaccactcattattttggacaatcctttgccctaacggcggcggtgctccaactggtgaa
ttagcagacgctatcgctagcaaattcggcagctttgatcaattcaaagaagaatttgca
aatgcagctaaaactcgcttcggttctggctgggcttggttagttgtaaacaacggcgaa
ttagaagtaacaagcacaccaaaccaagatagcccattaatggaaggcaaaacgccaatt
cttggtctagacgtttgggagcacgcttactacttaaattaccaaaaccgccgtccagat
tacatttcagcattctttaatgttgtaaaatgggacgaagttgctaagcgttacgacgct
gcaaaataa

DBGET integrated database retrieval system