KEGG   Bacillus megaterium QM B1551: BMQ_4616Help
Entry
BMQ_4616          CDS       T01208                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMQ_4616
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMQ_4616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4435007..4437364)
Genome map
AA seq 785 aa AA seqDB search
MNEEQVNPSQPERHYISGTSIVTVFHNEENLYNVTRIRIKKTNLEIEDKETVVTGYFPKL
NEDEVYTFYGDFKEHPKFGLQFHVEQFKKELPQSRQGVVQYLSSDLFHGIGKKTAENIVD
ALGERAIFRILQNESVLKEVPRLSADKAEALVTQLREHQGLEEVMVKLTDLGFGPQLSMK
IFQAYKQEALEIVQNNPYQLVEDIQGIGFSRADELGKRLGMATNHPDRLRAGILYVIEQE
CNQMGHVYVTADQLYGKTAELLRKSRHENLSEMDLTREVDALKADKKLIIQDEKIYFPPL
FYAEKGLVKAIQKIMAQTQYEEQFPESEFLLALGELEERLDVQYAPSQRKGIQTALMSPM
LLLTGGPGTGKTTVIKGIVELYAELHGCSLNPGDYKKDEAFPVLLVAPTGRAAKRMSEAT
GLPAVTIHRLLKWNGQEGFDHNEENPIDGKLLIVDEVSMVDLWLAHQLFKSLPANLQVIL
VGDEDQLPSVGPGQVLKDLLSSEVVPTVRLTDVYRQAEGSSIIDLAHEIKKGKLPEDLSR
QQGDRSFIRCQGQHITNVVQQVCGNALKKGYTAKDIQVLAPMYKGPAGIDKLNEVLQELF
NPASEQRRELKHGDITYRVGDKVLQLVNQPDSNVFNGDMGEIVSVFFAKENTEKQDMLVI
SYEGNEVTYTKQDFNQITHAYCCSIHKSQGSEFPIVVLPIVKSYYRMLRRNLLYTAVTRS
KQFLILCGEDEAFQLGVSRNEDSVRQTNLQPLLRESLDNDIEDPEIPFMKDANIGMENVT
PYDFM
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagaacaagtgaacccttcacagccagaacgtcattatataagcggcacgtcg
attgtaacggtctttcataacgaagaaaacttatataacgttacgcggatacggatcaaa
aaaacaaatttagagattgaagataaagaaacggtcgttacaggctattttcctaagctg
aatgaagatgaagtatacacgttttacggagacttcaaagagcacccaaagtttggtctg
cagtttcatgttgaacagtttaaaaaagaacttccgcaatcaaggcaaggggttgttcag
tacctgtctagcgatttatttcacggaatcggtaaaaaaaccgctgaaaacattgtggac
gccctaggagaacgcgctatttttcgtattttgcaaaatgagtctgtgctaaaagaggtt
ccgaggctttcagccgacaaggcagaagctttagtcacgcagcttcgtgaacatcaaggg
ttagaagaagtaatggtaaagctgacagacctcgggtttggaccgcagctttcgatgaag
attttccaagcgtacaaacaagaagcgcttgaaattgttcaaaataatccttatcagctc
gtagaagatattcaaggtattggctttagcagagccgatgaacttggaaagaggcttggt
atggcaaccaatcatcctgatcgtttgcgtgcaggtattttatatgtcattgagcaagaa
tgcaatcaaatgggacatgtatacgtcacggcagatcagctgtatggaaaaacagcagag
cttcttcgaaaaagcaggcatgagaatctgtctgaaatggatcttacaagagaagtggac
gcattaaaagcagacaaaaagcttatcattcaagacgaaaaaatttattttcctcccctt
ttctatgctgaaaaagggctggttaaagctattcaaaaaattatggctcaaacgcagtac
gaagagcagtttccagaatcagaattcttattggcactgggtgaactagaagagcgatta
gacgtgcaatatgcaccttctcagcgcaagggcatacaaaccgctttaatgtctccgatg
cttctcttaacaggtggaccaggtacagggaaaacaacggttattaaaggaatagtcgaa
ctctatgcagaacttcacggatgttcgttaaatccaggggattataaaaaagatgaagct
tttcctgttttacttgtggcacctactggacgcgctgctaaacgaatgagcgaagcgacg
ggacttccggcagttacaattcacagattattaaaatggaacggacaagaaggatttgat
cataatgaggagaatccaattgacggaaaattactgattgtggatgaagtatcaatggta
gatttgtggcttgctcatcagctgtttaaatctcttcctgctaatttacaggttatttta
gttggagacgaagaccagcttccttcagtaggtccgggacaggtgttaaaagatttactg
agttcagaagtagttcctaccgtccgtctgacagatgtataccggcaagcggaaggatct
tcaattattgatttggctcatgaaataaaaaaaggaaagcttccggaagacttatccagg
cagcaaggagatcgttcctttattcgttgtcaaggacagcacatcacgaacgtcgtgcaa
caagtttgcgggaatgcgttaaaaaaaggctatacggctaaagatattcaagttctagct
cctatgtataaaggtcctgcaggtattgataagctgaatgaagttcttcaggaattattc
aacccggcttctgagcaaagaagagagcttaagcacggagatattacgtaccgagtcgga
gataaagtgctgcagcttgtaaatcagccggatagcaacgtatttaacggagatatggga
gaaatcgtctcggttttttttgccaaagaaaatacggaaaaacaggatatgctggttatt
tcatatgaaggaaatgaagtaacttacacaaagcaagactttaatcaaataactcatgca
tactgctgttccattcataaatcacagggaagtgaatttcccattgttgtgcttccaatt
gttaaaagctattaccggatgctgcgacgcaatttactttataccgccgttacgcgaagc
aaacagtttttaattttatgcggcgaagacgaagcgtttcagcttggagtcagccgaaat
gaagacagcgtccgacaaacgaatttacagcccttgcttcgagaaagcttggataacgac
atagaagatcccgaaattccatttatgaaagatgcaaatattgggatggaaaacgttacg
ccgtatgatttcatgtaa

DBGET integrated database retrieval system