KEGG   Bacillus megaterium QM B1551: BMQ_4732Help
Entry
BMQ_4732          CDS       T01208                                 

Gene name
fadB
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BMQ_4732 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BMQ_4732 (fadB)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMQ_4732 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4555758..4556531)
Genome map
AA seq 257 aa AA seqDB search
MEIIQVETVDAISFITLNRQPANALSQDLLKDLSSVLKHLEDSKETRVIVIKGEGKFFCA
GADIKEFTSLQQEKEYEKLAVNGQELFEYIENYPKPVIAAIHGAALGGGLELAMSCHIRL
VTENAKLGLPELQLGIIPGFGGTQRLPRYVGVHKACEMMLTSDPISGSEAVELGLANAAF
EESQLINETFLLARKIAKKSPISVKATLQLLQHVKTDAYYSGIKKEAQFFGSVFKSRDAQ
EGVAAFIEKRQPKFLGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagattatccaggttgaaactgttgatgcaataagcttcattacgttgaatagacaa
cctgctaacgctttgtctcaagatttattaaaagatctttcaagtgttttaaaacattta
gaagatagtaaagagacaagggttatcgttattaaaggtgaagggaaattcttttgtgcc
ggggctgatataaaagaattcacatcacttcagcaggaaaaagaatacgagaagcttgct
gttaacggtcaagagctctttgagtatattgaaaattacccaaaaccagtgattgcagct
attcatggagctgctttaggcggaggattggagcttgctatgagctgccatatccgtttg
gtaacggaaaatgctaagctgggcttgcctgagcttcagttaggaattataccaggattt
ggaggaactcagcgattgcctcgttatgtaggagttcataaggcttgtgagatgatgctg
acaagtgatccaatatccggaagcgaggcagtggagttaggattggcaaatgcagctttt
gaagaaagtcagcttatcaatgaaacatttttacttgctagaaaaattgccaaaaaaagc
ccaatctctgttaaagctaccttgcagctgcttcagcatgtaaaaacagatgcttactac
agcggcattaaaaaagaagcgcagttttttggaagcgtattcaaaagccgggatgctcaa
gaaggcgtagccgcttttattgaaaagcgccagcctaaatttttaggaaaataa

DBGET integrated database retrieval system