KEGG   Bacillus megaterium QM B1551: BMQ_4746Help
Entry
BMQ_4746          CDS       T01208                                 

Definition
M42 glutamyl aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMQ_4746
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BMQ_4746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4572233..4573318)
Genome map
AA seq 361 aa AA seqDB search
MTKLDETLTMLKALTDAKGIPGNEREPREVMKKYIAPYADEVTTDGLGSLIAKKVGNEQG
PKIMVAGHLDEVGFMVTQIDERGFIRFQTVGGWWSQVMLAQRVTIVTSKGEVTGIIGSKP
PHILPPEVRKKPVDIKDMFIDIGASSREEVAEWGVKPGDQVVPYFEFTVMNNEKMLLAKA
WDNRIGCAIAIDVLKALKNETHENVVYGVGTVQEEVGLRGAKTSANFIEPDIAFAVDVGI
AGDTPGVSDKEASSKMGDGPQIILYDASMVSHKGLRDTVVNVADELNIPYQFDAIAGGGT
DSGSIHISANGVPALSITIATRYIHSHAAMLHRDDYENAVKLIAEVIKRLDRNTVNAITY
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttagatgaaacattgacgatgcttaaagcactaacagatgcaaaaggaatt
cctggcaatgagcgtgaaccgcgtgaggttatgaagaaatatattgcaccttatgcagat
gaagtaacgacggatgggctaggcagtttgattgcaaaaaaagtgggcaacgaacaaggg
cctaaaattatggtagccggtcacttagatgaagtaggctttatggtgactcaaattgat
gaacgcggctttattcgttttcaaacggtaggcggatggtggtctcaagttatgcttgct
caacgcgtaaccatcgttacatctaaaggagaggtaacggggattattggctcaaagcct
cctcatatcctgcctccagaagttcgtaaaaagcccgttgacattaaagatatgttcatc
gatattggtgcctctagcagagaagaagtagcggagtggggagtgaaacctggtgatcag
gttgtgccttatttcgaatttacggttatgaacaacgaaaagatgctgctagcgaaagcc
tgggataaccgtatcggctgtgcaatcgctatcgatgtattaaaagctttaaaaaatgaa
acacatgaaaatgttgtgtatggtgtaggaacggtgcaagaagaagttggacttagaggt
gcaaaaacatccgctaactttattgaaccggatattgcatttgctgttgatgtcggtatc
gctggagatacacctggtgtttctgataaagaagcatcttctaaaatgggagatggtccg
caaatcattttatatgatgcttccatggtttctcataaaggacttcgagatacagtggta
aatgtggcagatgaattaaatattccatatcaatttgatgcaatcgctggaggcggtacg
gactcaggttctatccatatttcagctaacggggtgccagcactttcgattacgatcgca
actcgttatatccattctcatgcagcgatgcttcatcgtgatgattatgaaaatgcagtt
aaattaattgcggaagtaattaaacgcttagaccgaaatacggtgaacgcaattacgtat
aattaa

DBGET integrated database retrieval system