KEGG   Bacillus megaterium QM B1551: BMQ_4746Help
Entry
BMQ_4746          CDS       T01208                                 

Definition
(GenBank) M42 glutamyl aminopeptidase
Organism
bmq  Bacillus megaterium QM B1551
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4572233..4573318)
Genome map
AA seq 361 aa AA seqDB search
MTKLDETLTMLKALTDAKGIPGNEREPREVMKKYIAPYADEVTTDGLGSLIAKKVGNEQG
PKIMVAGHLDEVGFMVTQIDERGFIRFQTVGGWWSQVMLAQRVTIVTSKGEVTGIIGSKP
PHILPPEVRKKPVDIKDMFIDIGASSREEVAEWGVKPGDQVVPYFEFTVMNNEKMLLAKA
WDNRIGCAIAIDVLKALKNETHENVVYGVGTVQEEVGLRGAKTSANFIEPDIAFAVDVGI
AGDTPGVSDKEASSKMGDGPQIILYDASMVSHKGLRDTVVNVADELNIPYQFDAIAGGGT
DSGSIHISANGVPALSITIATRYIHSHAAMLHRDDYENAVKLIAEVIKRLDRNTVNAITY
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttagatgaaacattgacgatgcttaaagcactaacagatgcaaaaggaatt
cctggcaatgagcgtgaaccgcgtgaggttatgaagaaatatattgcaccttatgcagat
gaagtaacgacggatgggctaggcagtttgattgcaaaaaaagtgggcaacgaacaaggg
cctaaaattatggtagccggtcacttagatgaagtaggctttatggtgactcaaattgat
gaacgcggctttattcgttttcaaacggtaggcggatggtggtctcaagttatgcttgct
caacgcgtaaccatcgttacatctaaaggagaggtaacggggattattggctcaaagcct
cctcatatcctgcctccagaagttcgtaaaaagcccgttgacattaaagatatgttcatc
gatattggtgcctctagcagagaagaagtagcggagtggggagtgaaacctggtgatcag
gttgtgccttatttcgaatttacggttatgaacaacgaaaagatgctgctagcgaaagcc
tgggataaccgtatcggctgtgcaatcgctatcgatgtattaaaagctttaaaaaatgaa
acacatgaaaatgttgtgtatggtgtaggaacggtgcaagaagaagttggacttagaggt
gcaaaaacatccgctaactttattgaaccggatattgcatttgctgttgatgtcggtatc
gctggagatacacctggtgtttctgataaagaagcatcttctaaaatgggagatggtccg
caaatcattttatatgatgcttccatggtttctcataaaggacttcgagatacagtggta
aatgtggcagatgaattaaatattccatatcaatttgatgcaatcgctggaggcggtacg
gactcaggttctatccatatttcagctaacggggtgccagcactttcgattacgatcgca
actcgttatatccattctcatgcagcgatgcttcatcgtgatgattatgaaaatgcagtt
aaattaattgcggaagtaattaaacgcttagaccgaaatacggtgaacgcaattacgtat
aattaa

DBGET integrated database retrieval system