KEGG   Bacillus megaterium QM B1551: BMQ_4841Help
Entry
BMQ_4841          CDS       T01208                                 

Gene name
ytjP
Definition
putative dipeptidase (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMQ_4841 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BMQ_4841 (ytjP)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BMQ_4841 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4669450..4670853)
Genome map
AA seq 467 aa AA seqDB search
MTAINWKEEVQKREAEILAETQRFLQIKSVLTSTEKQEEPFGPGIAQALHFLLNKGKNDG
FSVKNVDGYAGHIEAGEGKDLLGILCHVDVVPEGDGWSVDPYGGEIKDGKIFARGAIDDK
GPTMAAYYAMKIVKDLGLPLSKRVRIIIGTDEESDWRCVDHYFNHEEMPTMGFAPDADFP
IIFAEKGITDVEIRQQPIEGTKGSVQLTSFVSGRRYNMVPDLATAVLEFHSETDIENKYD
QFLKDQSLKGSITDKSGVYTLTLEGVSAHGSVPDKGKNAGLTLLRFLHTLELDEQANQFV
GYANAYLVQGALGEKMGLNRKDEVTGDLTINVGIMSYNQEEAGHFGLNIRYPVSAHIDDI
IDTIKEKSESYQMTIKHFTDSKPHHVDQKHELIQTLQKVYQEQTNEEPTLISIGGGTYAR
ALEAGVAFGPLFPGREEVAHEKDEYMVIEDLLRATAIYAQAIYELAK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaattaattggaaagaggaagttcaaaaaagagaagctgaaattctagctgag
acgcagcgttttctacaaattaaaagtgttttgacaagcacagaaaaacaagaagagcca
ttcggacctggaattgctcaagcgcttcactttcttttaaataaaggaaaaaatgacggg
ttttccgtcaagaacgtagacggatatgctggtcatattgaggcaggagaagggaaagac
cttcttggcattctttgtcacgtagacgttgttcctgaaggagacgggtggtcggttgat
ccatacggcggtgaaataaaagacgggaaaatttttgctagaggagcaatcgatgataaa
ggcccgacgatggctgcttattatgcgatgaaaattgtgaaagatttagggcttcctcta
tctaaacgggtgcgaataattattggaacggatgaagaaagtgactggagatgtgtggac
cactacttcaaccatgaagagatgccaactatgggatttgcgccggatgcggattttcct
atcatttttgctgaaaaaggcattacagacgtagaaattcgccagcagccaattgaagga
acaaagggaagcgttcagcttacatcatttgtctctgggcgacgctacaatatggttcct
gatcttgcaacagctgttcttgaattccatagtgaaacggatattgaaaataaatatgat
caatttttaaaggatcagtctttaaaaggctcaataacagacaagagcggtgtatacaca
cttactttagaaggcgtttcagcacatggaagtgtgcctgataaagggaaaaatgctggc
cttacgcttcttcgctttttacacacattagaacttgatgaacaagctaatcagtttgta
ggttatgcaaatgcgtatttagtccaaggtgcactaggagaaaaaatgggcttaaatcgc
aaagatgaggtcacgggtgatttaacgataaatgttggaatcatgtcttacaatcaagaa
gaagcggggcactttggtttaaacattcgctatcctgtatcagctcatattgacgatatt
attgatacgattaaagaaaaaagtgaatcttatcaaatgaccatcaaacattttacagat
tctaaaccgcatcacgtcgatcaaaaacatgagcttattcaaacgcttcaaaaggtttac
caagaacaaacaaatgaagaacctacacttatttcaattggaggaggaacatatgccaga
gcattagaagcgggtgtggcatttggacctcttttcccaggccgtgaagaagtagcgcac
gaaaaagacgagtacatggtaattgaagatttacttcgtgcaacagctatttatgcacag
gctatttacgaattagctaaataa

DBGET integrated database retrieval system