KEGG   Bacillus megaterium QM B1551: BMQ_4857Help
Entry
BMQ_4857          CDS       T01208                                 

Definition
lysophospholipase (EC:3.-.-.-)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMQ_4857
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMQ_4857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4686111..4686887)
Genome map
AA seq 258 aa AA seqDB search
MHKWEAVNPKGVIVMVHGAAEHHGRYRWLIEMWRSVGMHVIMGDLPGQGLTTRRRGHILS
FDEYVYEVEEWVREAQKYDLPIFLLGHSMGGLAVIRTLQTKNLPIWGAILSSPCLGLKEQ
VPAYLDMLSKGLNKVMPNKLFDLGLTVEKATRNQEVRDEDENDSLYVTKVSVRWYRELIQ
AVNLAFKDIDRLPDVPLLVMQAGEDKIIEKLIVRQWFDEIELSEKIYKEWSQLYHEIFNE
PEREYVFTYAKSFVDLHI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatgggaagcagtaaatccaaaaggcgttattgtcatggtccatggagcagcg
gagcatcacggacgctatcgctggctgattgagatgtggcgttcggttggaatgcacgta
attatgggagaccttcctggccaaggcttaacaacaagaagaagaggacatatcctatcc
tttgatgaatatgtgtatgaagtggaagaatgggtacgtgaagcgcaaaaatatgatttg
cctattttcctgttaggtcacagtatgggaggactggcggttattcgtacgctccagaca
aaaaacctccctatatggggtgcgattctttcctctccttgtctaggattaaaagagcaa
gtaccggcttatttagatatgctatctaaagggttaaataaagtcatgccgaacaaactt
ttcgatttaggtctcactgttgaaaaagcaacaagaaaccaagaagttcgagatgaagat
gaaaatgactcactgtatgttacaaaagtttctgtaagatggtaccgggaattgatccaa
gctgtcaacttagcttttaaagatatcgatcgtttgcctgatgtcccgcttcttgtgatg
caggcaggagaagataaaattattgaaaagctgattgttaggcagtggtttgatgaaata
gagctaagtgaaaaaatctacaaagaatggtctcagctgtatcacgaaatctttaatgag
cctgaaagagaatacgtttttacatatgcgaaaagttttgtcgatcttcacatttaa

DBGET integrated database retrieval system