KEGG   Bacillus megaterium QM B1551: BMQ_4975Help
Entry
BMQ_4975          CDS       T01208                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMQ_4975 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_4975 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMQ_4975 (thrC)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMQ_4975 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4780471..4781532)
Genome map
AA seq 353 aa AA seqDB search
MWKGLLAEYKEFLPVTEKTPMLTLHEGNTPLIHLAYLSKELGIDLHVKVEGLNPTGSFKD
RGMVMAVAKAKEEGSNTVICASTGNTSAAAAAYASRAGMRCIVVIPNGKIAMGKLAQAVM
YGAEIVAIEGNFDQALSMVRKLSETSPVALVNSVNPYRIEGQKTASFEICEQLGKAPDVL
AIPVGNAGNITAYWKGFKEYSERHQTSLPHMHGFEAEGAAAIVRNQVIENPETIATAIRI
GNPASWDYAVNAAKESNGKIDEVTDEQILEAYRTIARKEGVFAEPGSCASIAGVFKDVAS
GKIAKGSTVVAVLTGNGLKDPNVAIDAHNVKPVVLPNDEEKVFEYIQGVVASC
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggtctattagctgaatataaagagtttttacctgtaacagagaaaacacct
atgcttacactacatgaaggaaatacacctttaattcatctcgcttatttatcaaaagag
ctaggcattgatttacatgtgaaagtagaagggttaaatccaacggggtcatttaaagac
cgcggaatggtaatggctgtagcaaaagccaaagaagaaggaagtaatacggttatttgt
gcatctacaggtaacacatccgcagctgcagcagcttatgcatcacgcgctggcatgcgc
tgtatcgttgttattccaaatgggaaaattgcgatggggaaattagctcaagctgttatg
tatggtgcagaaattgtagcaattgaaggaaactttgaccaagcgctttctatggttcgt
aagctgagtgaaacatcaccggttgcacttgtaaactctgtaaacccatatcgtattgaa
gggcaaaaaacagcttctttcgagatttgtgaacagcttggaaaagcgcctgacgtttta
gctatcccagtggggaatgcagggaatattacagcttactggaaaggattcaaagaatac
agtgagcgtcaccaaacgtctcttcctcacatgcacgggtttgaagcagaaggtgcagcc
gcgatcgtgcgtaatcaagttatcgaaaatccagaaacaattgcaacggctattcgaatc
ggaaatccagcaagctgggattatgctgtaaacgcagcaaaagaatcaaacggaaaaatt
gatgaagtaacagatgaacaaatcttagaagcatatcgtacaattgcacgcaaagaaggt
gtatttgcagagccaggttcttgcgcttcaatagctggtgtgtttaaagatgtagcttct
ggtaaaattgcaaagggttcaacggttgtagctgtattaacaggtaacggattaaaagat
ccaaacgtagcaatcgatgctcataatgtaaagccagtggttttaccaaatgatgaagaa
aaggtatttgagtatatccaaggtgtcgttgcttcatgctag

DBGET integrated database retrieval system