KEGG   Bacillus megaterium QM B1551: BMQ_4975Help
Entry
BMQ_4975          CDS       T01208                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00260  Glycine, serine and threonine metabolism
bmq00750  Vitamin B6 metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01230  Biosynthesis of amino acids
Module
bmq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_4975 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMQ_4975 (thrC)
Enzymes [BR:bmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMQ_4975 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE71954
UniProt: D5DV82
Position
complement(4780471..4781532)
Genome map
AA seq 353 aa AA seqDB search
MWKGLLAEYKEFLPVTEKTPMLTLHEGNTPLIHLAYLSKELGIDLHVKVEGLNPTGSFKD
RGMVMAVAKAKEEGSNTVICASTGNTSAAAAAYASRAGMRCIVVIPNGKIAMGKLAQAVM
YGAEIVAIEGNFDQALSMVRKLSETSPVALVNSVNPYRIEGQKTASFEICEQLGKAPDVL
AIPVGNAGNITAYWKGFKEYSERHQTSLPHMHGFEAEGAAAIVRNQVIENPETIATAIRI
GNPASWDYAVNAAKESNGKIDEVTDEQILEAYRTIARKEGVFAEPGSCASIAGVFKDVAS
GKIAKGSTVVAVLTGNGLKDPNVAIDAHNVKPVVLPNDEEKVFEYIQGVVASC
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggtctattagctgaatataaagagtttttacctgtaacagagaaaacacct
atgcttacactacatgaaggaaatacacctttaattcatctcgcttatttatcaaaagag
ctaggcattgatttacatgtgaaagtagaagggttaaatccaacggggtcatttaaagac
cgcggaatggtaatggctgtagcaaaagccaaagaagaaggaagtaatacggttatttgt
gcatctacaggtaacacatccgcagctgcagcagcttatgcatcacgcgctggcatgcgc
tgtatcgttgttattccaaatgggaaaattgcgatggggaaattagctcaagctgttatg
tatggtgcagaaattgtagcaattgaaggaaactttgaccaagcgctttctatggttcgt
aagctgagtgaaacatcaccggttgcacttgtaaactctgtaaacccatatcgtattgaa
gggcaaaaaacagcttctttcgagatttgtgaacagcttggaaaagcgcctgacgtttta
gctatcccagtggggaatgcagggaatattacagcttactggaaaggattcaaagaatac
agtgagcgtcaccaaacgtctcttcctcacatgcacgggtttgaagcagaaggtgcagcc
gcgatcgtgcgtaatcaagttatcgaaaatccagaaacaattgcaacggctattcgaatc
ggaaatccagcaagctgggattatgctgtaaacgcagcaaaagaatcaaacggaaaaatt
gatgaagtaacagatgaacaaatcttagaagcatatcgtacaattgcacgcaaagaaggt
gtatttgcagagccaggttcttgcgcttcaatagctggtgtgtttaaagatgtagcttct
ggtaaaattgcaaagggttcaacggttgtagctgtattaacaggtaacggattaaaagat
ccaaacgtagcaatcgatgctcataatgtaaagccagtggttttaccaaatgatgaagaa
aaggtatttgagtatatccaaggtgtcgttgcttcatgctag

DBGET integrated database retrieval system