KEGG   Bacillus megaterium QM B1551: BMQ_5044Help
Entry
BMQ_5044          CDS       T01208                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Brite
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BMQ_5044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4847588..4848328)
Genome map
AA seq 246 aa AA seqDB search
MKIAQPKPFTFEGGEKAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPHYKGHGVAPEEL
VHTGPKDWWKDVMDGYEFLKSKGHESIAAVGLSLGGVFSLKLGYTVPIKGIVPMCAPMYI
KSEEVMYEGVLAYAREYKKREGKSSEQIEQEMEEFKQTPMNTLKSLQELIAEVRNSVDMI
YAPTFVVQGRHDHMINTDSANIIYNSVESPTKDIKWYEESGHTITFDKERDQLHEDVYAF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcacaaccaaagccatttacatttgaaggcggcgaaaaagctgttttatta
cttcatggttttaccggaaattctgctgacgttcgtatgttaggtcgttttttagagaaa
aaaggatacacatgccacgcacctcattacaaaggacatggcgtagcgcctgaagaactt
gttcatactggtccaaaagattggtggaaagatgtcatggacggctatgagtttttgaaa
agcaaaggtcatgaaagtattgccgctgtaggtctttcactaggtggcgtattttcactg
aaattaggttacactgtacctataaagggtattgtgcctatgtgcgcccctatgtatata
aagagtgaagaagtcatgtatgaaggtgttttagcgtatgcacgcgaatataaaaagcgt
gaaggtaaatcgtctgaacagattgaacaagaaatggaagagttcaagcaaacaccaatg
aacacattaaagtctttacaggaattaatcgctgaagtgcgaaattcagttgatatgatt
tatgcaccgacatttgttgtacaaggtcgtcatgatcatatgattaatacagacagcgcc
aatattatttataatagcgtcgagtctcctacaaaagatataaaatggtacgaagaatct
ggtcataccattacctttgataaagagcgtgatcagcttcacgaggatgtatatgcattt
ttggaatcacttgattggtga

DBGET integrated database retrieval system