KEGG   Bacillus megaterium QM B1551: BMQ_5048Help
Entry
BMQ_5048          CDS       T01208                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00051  Fructose and mannose metabolism
bmq00562  Inositol phosphate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
Module
bmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmq_M00002  Glycolysis, core module involving three-carbon compounds
bmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_5048 (tpiA)
   00051 Fructose and mannose metabolism
    BMQ_5048 (tpiA)
   00562 Inositol phosphate metabolism
    BMQ_5048 (tpiA)
Enzymes [BR:bmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMQ_5048 (tpiA)
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMQ_5048 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMQ_5048 (tpiA)
  Exosomal proteins of melanoma cells
   BMQ_5048 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Mt_ATP-synt_B
Motif
Other DBs
NCBI-ProteinID: ADE72027
UniProt: D5DVF5
Position
complement(4851890..4852645)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKVLSEATSFVEEVKGAVPSPESVESVVCAPALFLDRLVEATKGTDLK
IGAQNMHFEENGAFTGEVSPVALADLGVNYVILGHSERREMFAETDETVNQKTIAAFKHG
LTPIVCCGETNEEYEQDQTKTVVANQVQKALAGLTDEQVKQTVIAYEPIWAIGTGKSSTA
EGANEVCAYIRSVVAEQFSQDVADAVRIQYGGSVKPANIKEYMSQSDIDGALVGGASLEA
DSFLQLLEAGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaacaaagtactttctgaagcaact
agctttgttgaagaagtaaaaggagcagtaccatctcctgaaagcgtagaatcagtagta
tgtgcacctgcactatttttagatcgtttagtagaagcgactaaaggcacagacttaaaa
attggtgcacaaaacatgcactttgaagaaaacggtgcgttcactggagaagtgagccct
gttgctttagcagacttaggtgtgaactatgtcattttaggacactctgagcgtcgtgaa
atgtttgctgaaacggacgaaacagtaaaccaaaaaacaattgctgcattcaaacacggt
ttaacaccaatcgtttgctgcggtgaaacaaacgaagagtacgaacaagatcaaacaaaa
acagttgtagctaatcaagtacaaaaagcattagctggtctaactgatgagcaagtaaaa
caaacggttatcgcatatgagccaatctgggcaatcggtacaggtaaatcttcaactgct
gaaggtgcaaacgaagtttgtgcatacatccgtagcgttgttgcagaacaattctctcaa
gatgttgcagatgctgtacgtattcaatacggaggtagcgtaaaacctgctaatattaaa
gaatatatgtctcaatcagacattgacggagctttagtaggtggagcaagcttagaagca
gattctttcttacagcttttggaggctggtaagtaa

DBGET integrated database retrieval system