KEGG   Bacillus megaterium QM B1551: BMQ_5048Help
Entry
BMQ_5048          CDS       T01208                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_5048 (tpiA)
   01230 Biosynthesis of amino acids
    BMQ_5048 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_5048 (tpiA)
   00051 Fructose and mannose metabolism
    BMQ_5048 (tpiA)
   00562 Inositol phosphate metabolism
    BMQ_5048 (tpiA)
Enzymes [BR:bmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMQ_5048 (tpiA)
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMQ_5048 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMQ_5048 (tpiA)
  Exosomal proteins of melanoma cells
   BMQ_5048 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4851890..4852645)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKVLSEATSFVEEVKGAVPSPESVESVVCAPALFLDRLVEATKGTDLK
IGAQNMHFEENGAFTGEVSPVALADLGVNYVILGHSERREMFAETDETVNQKTIAAFKHG
LTPIVCCGETNEEYEQDQTKTVVANQVQKALAGLTDEQVKQTVIAYEPIWAIGTGKSSTA
EGANEVCAYIRSVVAEQFSQDVADAVRIQYGGSVKPANIKEYMSQSDIDGALVGGASLEA
DSFLQLLEAGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaacaaagtactttctgaagcaact
agctttgttgaagaagtaaaaggagcagtaccatctcctgaaagcgtagaatcagtagta
tgtgcacctgcactatttttagatcgtttagtagaagcgactaaaggcacagacttaaaa
attggtgcacaaaacatgcactttgaagaaaacggtgcgttcactggagaagtgagccct
gttgctttagcagacttaggtgtgaactatgtcattttaggacactctgagcgtcgtgaa
atgtttgctgaaacggacgaaacagtaaaccaaaaaacaattgctgcattcaaacacggt
ttaacaccaatcgtttgctgcggtgaaacaaacgaagagtacgaacaagatcaaacaaaa
acagttgtagctaatcaagtacaaaaagcattagctggtctaactgatgagcaagtaaaa
caaacggttatcgcatatgagccaatctgggcaatcggtacaggtaaatcttcaactgct
gaaggtgcaaacgaagtttgtgcatacatccgtagcgttgttgcagaacaattctctcaa
gatgttgcagatgctgtacgtattcaatacggaggtagcgtaaaacctgctaatattaaa
gaatatatgtctcaatcagacattgacggagctttagtaggtggagcaagcttagaagca
gattctttcttacagcttttggaggctggtaagtaa

DBGET integrated database retrieval system