KEGG   Bacillus megaterium QM B1551: BMQ_5130Help
Entry
BMQ_5130          CDS       T01208                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMQ_5130 (galU)
   00052 Galactose metabolism
    BMQ_5130 (galU)
   00500 Starch and sucrose metabolism
    BMQ_5130 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_5130 (galU)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMQ_5130 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4934960..4935844)
Genome map
AA seq 294 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVSGRGK
RAIEDHFDKSYELEETLAAKEKWDMLEEVQGISNLANVHYIRQKEPKGLGHAIHCARSFI
GDEPFAVMLGDDVVQSETPCLKQLMDVYEKYGCAVVGVQEVPRKETSKYGIVGPKGEPLE
KGLLDVETLVEKPNPEEAPSGYAIMGRYILTPEIFDILSKEEIGAGGEIQLTDAILRLNE
FQRVLAYYFEGKRYDVGDKFGFIKATIDLALQREPLREELVSYFREIVEKEGHM
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattcgtaaagctattattccagcagctggattagggacacgctttttgccggct
acaaaagcacagcctaaagaaatgctgccaattgtagataaaccaacgattcaatacatt
gtggaagaagcagtagcatcaggtattgaagatattttaattgtaagcggtcgcggaaaa
cgagcaatcgaagatcattttgataaatcatatgagttagaagaaacattagccgcaaag
gaaaagtgggacatgctcgaagaagtgcaggggatttcgaatttggctaatgttcactac
attcgtcaaaaggaacccaaaggattaggtcatgccattcactgtgcaagaagttttatc
ggagatgaaccttttgctgttatgctaggcgatgatgtagttcaatcagaaacaccttgt
ttgaaacagttaatggacgtatacgaaaaatatggatgcgctgtagttggtgtacaggag
gtgcctaggaaagaaacttcaaagtacggaattgtaggtcctaaaggagagcctcttgaa
aaaggattattagacgtagaaacgctcgttgaaaaaccgaatccagaagaggccccttca
ggctatgcaattatggggcgctatattttaacaccggaaatttttgatattttaagtaaa
gaagagattggcgcaggaggagaaattcaattaaccgatgctattttacgtctgaatgaa
tttcaacgtgttcttgcttattatttcgaaggaaaacgttatgatgttggagataaattt
ggattcattaaagcaacaattgatttagctctgcaaagagaaccgctgcgagaagagtta
gtgagctattttagagaaattgtcgaaaaagaagggcatatgtaa

DBGET integrated database retrieval system