KEGG   Bacillus megaterium QM B1551: BMQ_5144Help
Entry
BMQ_5144          CDS       T01208                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_5144 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMQ_5144 (murA)
Enzymes [BR:bmq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BMQ_5144 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4950232..4951536)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGNRLSGTVKVEGAKNAVLPIITATLLASEGKTILNDVPALSDVFTIGEVLRH
LNAEVDFETNRVVVDASRELKTDAPFEYVRKMRASVLVMGPLLARTGEARVALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFIDAKVEGRLKGAKIYLDFPSVGATENIMMAAALAEG
TTIMENVAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVNKLYGAEHAIIPDRIEAGTF
MVAAAITGGNVLVRGAVAEHISSLVAKMEEMGVEITEEGDGLRVVGPEKLKSVDIKTMPH
PGFPTDMQSQMMALLLAAEGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIINGPSQ
LQGAEVAATDLRAAAALTLAGLVADGYTRVTELKHLDRGYVNFHNKLAALGADIERVNDE
TKQVEQTQQASDVK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggtggaaatagattaagcggtacagttaaagttgaagga
gcaaaaaacgccgttttacctattatcactgcaaccttattagctagtgaaggaaaaaca
attctaaatgatgtaccagctctctccgatgtatttacgattggcgaagttttaagacat
ctgaatgcagaagtagattttgaaacaaatcgtgtagttgtagatgcatcaagagagtta
aaaacagatgcaccttttgaatatgtaagaaaaatgcgcgcttcagtacttgtaatgggt
cctttattggcgcgtacaggtgaggctcgtgtagctttacctggcggatgtgcgattgga
tcaagaccgattgatcagcatcttaaaggctttgaagcaatgggtgctaaagttcaagta
ggaaatggttttattgatgcaaaagttgaaggaagactaaaaggtgctaaaatttattta
gacttcccaagtgtaggtgccacagaaaatattatgatggcagcagcattagcggaaggc
actacaattatggaaaacgtagcaaaagaacctgagattgtcgacttagcaaacttctta
aacgcaatgggcgctaaagttcgcggtgcaggaactggtacgatccgtattgaaggtgtt
aataaattatatggtgcagaacatgcaattattccagatcgtatcgaagctggaacattc
atggtagcagcagctattacaggtggaaacgtacttgtacgcggtgcagtagcagagcac
atcagttcacttgttgctaaaatggaagaaatgggtgttgaaattactgaagaaggcgac
ggcttacgtgttgtaggacctgaaaagctaaaatcagtagatattaaaacaatgcctcat
ccagggttccctacggatatgcaatctcaaatgatggcattattattagcagcagaaggc
acaagtatgattacagaaacagtttttgaaaaccgctttatgcacgtagaagagtttcgc
cgcatgaacgctgatattaaaattgaagggcgctctgttattattaacggaccttctcaa
ctacaaggcgctgaagtagcagcaacagatcttcgtgcagcagcagcgttaacattagca
ggacttgtagcagacggctatacgcgtgtaacggaattaaaacaccttgatcgtggttat
gtaaatttccacaataaattagccgctttaggcgctgatattgaacgtgtaaatgacgaa
acaaagcaagtagaacaaactcaacaggcttcagacgtcaaataa

DBGET integrated database retrieval system