KEGG   Bacillus megaterium QM B1551: BMQ_5231Help
Entry
BMQ_5231          CDS       T01208                                 

Gene name
cydA
Definition
(GenBank) cytochrome d ubiquinol oxidase, subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00190  Oxidative phosphorylation
bmq01100  Metabolic pathways
bmq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    BMQ_5231 (cydA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMQ_5231 (cydA)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     BMQ_5231 (cydA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I
Motif
Other DBs
NCBI-ProteinID: ADE72208
UniProt: D5DWP3
Position
complement(5040791..5042197)
Genome map
AA seq 468 aa AA seqDB search
MDTVILSRIQFASTTLFHFIFVPLSIGLVFLVAIMETMYVVKKDEQYKKMAKFWGHLFLI
NFAVGVVTGILQEFQFGMNWSEYSRFVGDVFGAPLAIEALLAFFMESTFLGLWIFGWDRL
PKWLHCLCIWLVSLGTIFSAFFILTANSFMQHPVGMELNNGRLEMNDFFKLLTNGQLWVE
FPHTILGSFATGAFFITGVSAIMLLKKKHVAFAKKSFQVAIIVGLVSGVGIALSGHEQAG
YLVKTQPMKMAASEGLWENSGSPGAWTVTANIHPNEKKNTSEIKIPYLLSFLSYGKFSGS
VPGMNELQEQYTAKYGAGNYIPPVRTTFWSFRIMAGLGGVLCALGIWGTYLLSRKKLQES
KLFLRIMTIAIAFPFLGSSAGWIMTEIGRQPWVVFGYMKTEDAVSPGVTAGELLFSIISF
SFFYLILAVIMVFLFVKEIKKGPDHDHEAHTKVVSTDPFTKEGYNVFS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatacagttatactatcacgtattcaatttgcatcaacgacgctgtttcattttatc
tttgtaccgctatctatcggtcttgtctttttagtagcgatcatggaaacgatgtacgta
gtaaaaaaagatgaacagtataaaaagatggcaaagttttgggggcacttattcctgatt
aactttgctgtcggagtcgtaacaggtattttacaagaatttcagtttggcatgaactgg
tcagagtactcacggtttgtaggagatgtattcggtgcgccgcttgctattgaagcactg
ctcgcgttttttatggagtccactttcctcggactgtggattttcgggtgggatcgtttg
cctaaatggctgcactgtctatgtatttggcttgttagtctaggtactattttttcagcg
ttctttattttaacggctaattcttttatgcagcatccggttggaatggagctgaataat
ggacgtttagaaatgaatgacttctttaaattgttaacaaacggtcagctgtgggttgaa
ttccctcataccattttaggttcgtttgcaacaggcgccttttttatcacgggtgtcagt
gccattatgctcttgaagaaaaaacatgtggcttttgccaaaaaatcatttcaagttgcc
attattgtagggttagtttcaggtgtaggaattgcgttatctggtcatgaacaggctgga
tacttagttaaaacacagccgatgaaaatggccgcaagtgaaggattatgggaaaatagc
gggagtccaggcgcttggacggtaacagcaaatattcaccccaatgaaaagaaaaatacg
agtgaaatcaaaataccttatttattaagcttcttatcatacgggaaattttcaggttcc
gttcctgggatgaacgagctgcaggagcagtacacggcgaaatatggagcaggaaattat
attccacccgttcggacaacattttggagtttccgcattatggctggtctaggtggggta
ttatgtgcattaggtatttggggcacgtacttgctttctcgtaaaaaacttcaagaaagc
aaactatttttacgtattatgacgattgccattgcctttccgttccttggaagctcagca
ggttggattatgacagagattggccgtcagccttgggttgtatttggctatatgaaaacg
gaagatgccgtgtctcctggtgtaacagcaggtgaattgctgttttctattatctcgttt
tcgttcttttatttaattttagctgtgattatggtgttcttgttcgttaaagaaattaaa
aaaggtccagatcacgatcacgaagcacatacaaaagtagtatcaactgatccgtttaca
aaggagggatacaatgttttctcttaa

DBGET integrated database retrieval system