KEGG   Bacillus megaterium QM B1551: BMQ_pBM70106Help
Entry
BMQ_pBM70106      CDS       T01208                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMQ_pBM70106
   01230 Biosynthesis of amino acids
    BMQ_pBM70106
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_pBM70106
  Energy metabolism
   00680 Methane metabolism
    BMQ_pBM70106
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_pBM70106
Enzymes [BR:bmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMQ_pBM70106
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMQ_pBM70106
  Exosomal proteins of melanoma cells
   BMQ_pBM70106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBM700:94041..94610
Genome map
AA seq 189 aa AA seqDB search
MKTFILVRHCKAEGQEEGAILTEEGKKEAINLITYLNKVNCKITKIISSPYERAVKTIEP
YAKEVGLSIQIDNRLSERRLSNKSLTNWLELLKQTFDDIDLVIEGGESTREATERAINLI
REEIEYSKEQNTLLVTHGNLMSLILRYFDESFGFNEWANLTNPDVYRIDIEDNQISIKRL
WDPMAYHSI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttatactggtaagacattgtaaagcagaaggacaagaagaaggggcaata
ttaactgaagaaggaaagaaagaagcgattaatcttattacttacttaaataaagtgaac
tgtaaaatcactaaaattatttctagtccgtatgaaagagctgtaaaaacaatcgaacct
tatgcaaaagaagtagggttaagtatacaaattgacaatagattatcagaaagaaggcta
agcaataaatcacttactaactggttagaactattaaaacaaactttcgatgatatagat
cttgttattgaagggggagaatccacaagggaagctacagagcgtgcaatcaaccttatc
agagaagaaatagaatatagcaaggaacagaatacgttgttagttacacatggaaacctt
atgagtttaattctgagatattttgacgaaagttttggttttaatgaatgggcaaaccta
acgaatccagatgtttatagaatagacattgaagataaccaaattagtatcaaaagactg
tgggacccaatggcataccatagtatctag

DBGET integrated database retrieval system