KEGG   Bacillus megaterium QM B1551: BMQ_pBM70106Help
Entry
BMQ_pBM70106      CDS       T01208                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00010  Glycolysis / Gluconeogenesis
bmq00260  Glycine, serine and threonine metabolism
bmq00680  Methane metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
Module
bmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmq_M00002  Glycolysis, core module involving three-carbon compounds
bmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMQ_pBM70106
  Energy metabolism
   00680 Methane metabolism
    BMQ_pBM70106
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMQ_pBM70106
Enzymes [BR:bmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMQ_pBM70106
Membrane trafficking [BR:bmq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMQ_pBM70106
Exosome [BR:bmq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMQ_pBM70106
  Exosomal proteins of melanoma cells
   BMQ_pBM70106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Antimicrobial_2
Motif
Other DBs
NCBI-ProteinID: ADE72648
UniProt: D5E4C3
Position
pBM700:94041..94610
Genome map
AA seq 189 aa AA seqDB search
MKTFILVRHCKAEGQEEGAILTEEGKKEAINLITYLNKVNCKITKIISSPYERAVKTIEP
YAKEVGLSIQIDNRLSERRLSNKSLTNWLELLKQTFDDIDLVIEGGESTREATERAINLI
REEIEYSKEQNTLLVTHGNLMSLILRYFDESFGFNEWANLTNPDVYRIDIEDNQISIKRL
WDPMAYHSI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttatactggtaagacattgtaaagcagaaggacaagaagaaggggcaata
ttaactgaagaaggaaagaaagaagcgattaatcttattacttacttaaataaagtgaac
tgtaaaatcactaaaattatttctagtccgtatgaaagagctgtaaaaacaatcgaacct
tatgcaaaagaagtagggttaagtatacaaattgacaatagattatcagaaagaaggcta
agcaataaatcacttactaactggttagaactattaaaacaaactttcgatgatatagat
cttgttattgaagggggagaatccacaagggaagctacagagcgtgcaatcaaccttatc
agagaagaaatagaatatagcaaggaacagaatacgttgttagttacacatggaaacctt
atgagtttaattctgagatattttgacgaaagttttggttttaatgaatgggcaaaccta
acgaatccagatgtttatagaatagacattgaagataaccaaattagtatcaaaagactg
tgggacccaatggcataccatagtatctag

DBGET integrated database retrieval system