KEGG   Brucella microti: BMI_I1032Help
Entry
BMI_I1032         CDS       T00955                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bmr  Brucella microti
Pathway
bmr00790  Folate biosynthesis
bmr01100  Metabolic pathways
Module
bmr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMI_I1032 (folP)
Enzymes [BR:bmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BMI_I1032 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACU48012
UniProt: C7LBX7
Position
1:999978..1000817
Genome map
AA seq 279 aa AA seqDB search
MTKEWQLAHERSLHLGKTAIIMGVLNVTPDSFSDGGRYNDLDRAIAAAETMLEEGATIVD
VGGESTRPGATAVDAQTEASRVVPVIRELVRRFDCIISVDTYRASTARLAVEAGAHIVND
VWGLQREPEIAQLARETGAGLVIMHTSRDRLTNPDVIEDQFMFLNRSLKIAGDAGIEPSR
IVLDPGFGFGKERDEDIALMARMSELQAFGFPLLVGTSRKRFVGAMTGQADPRNRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADAILQSNVRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaatggcagcttgcccatgaacgcagcctccatctcggaaaaaccgccatc
attatgggagtactgaacgttacgccggattctttctcggatggcgggcgttataacgat
cttgatcgtgccatcgccgctgccgaaacgatgctggaggaaggcgcgaccattgtggac
gttgggggcgaatcgacgcgaccgggcgctactgctgtggatgcgcagacagaagccagc
cgtgtggttccggtaatccgggaactggtgaggcgcttcgattgtatcatttccgtggac
acttatcgtgcttctaccgcgcggcttgcggtggaggccggcgcgcatatcgtcaatgat
gtctgggggcttcagcgcgaaccggaaattgcccagcttgccagagaaacgggggcaggg
cttgtcatcatgcatacgagccgcgaccgcctcacgaatcccgacgtgatcgaagatcag
tttatgttcctgaacaggtcgctgaaaattgccggggatgcaggcatcgagccatcgcgc
atcgtgcttgatccgggtttcggcttcggcaaggagcgggatgaagacattgcgttgatg
gcgcgtatgtctgaattgcaggccttcggattccccctgctggtcggtacatcgcgcaag
cggttcgttggcgcaatgacggggcaggccgatccgcggaaccgcgatatcggcacagcg
gctacttccgtggcccttcgcctggcgggagccgacatcttccgtgttcacaatgtcgct
tttaacagagatgcacttgcagttgcggatgctatcctgcaaagcaacgtcaggatctaa

DBGET integrated database retrieval system