KEGG   Brucella microti: BMI_I1669Help
Entry
BMI_I1669         CDS       T00955                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmr  Brucella microti
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMI_I1669 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMI_I1669 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMI_I1669 (glcB)
Enzymes [BR:bmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMI_I1669 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1605510..1607696
Genome map
AA seq 728 aa AA seqDB search
MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLAPKNRALLA
KRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGGAFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANTRWGSLYDALYGTDAISEADGAEKGKGYNPKRGEKVIAWAKNF
LDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDESQFKGYNGDAASPTNVLLAK
HNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCEDSIAAVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRTYTAPDGSTLTLKGRSLMLVRNVGHLMTNPAILDAE
GNEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDMMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHKIDVAAVQEKLKSRPRAKLDDILSVPVAVRPNWTPDDIQHE
IDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAIVDKQNEGDPLYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKQAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgcagaaaaacgtaactatgtcgagattgaaggcttggctgttgcccctgag
cttgtggaatttctggccaaagaagccgcgcccggcacaggcgtggagccggagaaattc
tggaagggctttgccgccatcattcgcgatctcgcaccaaagaaccgcgccctgctcgcc
aagcgtgacgagcttcaggccaggatcgacgcctggtacaaggaaaaccgcgacaagggc
tacagccaggccgattaccagcagtttctgaaagatatcggctatctcctgccggaaggt
ggagcgttttcggtttcgaccaccaatgtcgatcctgaaatcacccatattgccggtccg
cagcttgtcgtcccggtcatgaatgcgcgctatgcactcaacgccgccaatacgcgctgg
ggctcgctctatgatgcgctttatggcaccgacgcgatttccgaggccgatggcgcggaa
aagggcaagggctacaatccgaagcgcggtgaaaaggttattgcgtgggcgaagaatttc
ctcgatgaaagcgcaccgctcagcacgggcaaatgggccgatgttgccggtctcgccgtg
aacgacggcaagcttgaaatcaggctgaccgatggttcggcaaccaccttgaaggacgaa
agccagttcaagggctataatggcgatgccgccagcccaacgaatgtgcttcttgccaag
cacaatatgcatgttgatatcgtcatcaatgcagatcacccgatcggcaagaccgatccg
gcgcatattgccgatgtggttctggaatcggccatcagcacgatccaggattgtgaggac
tccattgccgccgtcgatgccgaagacaaggttgccgtctatcgcaactggctcggcctg
atgaatggcaagctggaagacacgttcgagaagaacggcaagcagatgacgcgccgcctc
aatggcgaccgcacctacacggcgccggacggttccacgctgacgctcaagggccgttcc
ttgatgctggtgcgcaatgtcggccacctgatgaccaacccggccattctggacgccgaa
ggcaatgaagtgccggaaggcatcatggatgcagccttcaccagcctgattgcgctgcat
gatatcggccccaatggccgccacatgaattcgcgcgaaggctcggtctatatcgtcaag
ccaaaaatgcatgggccggaagaagtggcattcgcaaatgaaatcttcacccggaccgaa
gaaatgctcggcatgaagccgaatacgctcaaaatcggcatcatggacgaagaacgccgc
acgaccgtcaatctcaaggaggcaatccgcgccgccaaggatcgcgtcgtcttcatcaat
accggcttcctcgaccgcacgggcgacgagatccacacctccatggaagcaggcccgatg
atccgcaagggcgacatgaagcaggctgcgtggatcggcgcctatgaacaatggaatgtc
gatatcggtctggaatgcgggctttccggccatgcgcagatcggcaagggcatgtgggcc
atgcccgacatgatggcggcaatgctggagcagaagatcgcgcatccgaaggccggtgcg
aacaccgcctgggtgccgtcgccgaccgccgccaccttgcacgctacccattaccacaag
atcgatgtagccgccgttcaggaaaagctgaaaagccgtccccgcgccaagctggacgat
atcctgtcggtgccggttgcggtgcgtccgaactggacgccggacgatatccagcacgaa
atcgacaacaatgcacaaggcattctcggctatgtcgtgcgctggatcgatcagggtgtc
ggctgctccaaggtgccggacatcaacaatgtcggcctgatggaagaccgcgcgacgctg
cgcatttccgcgcagcacatcgccaactggctctatcatggcgtcgtgtcagaggcacag
gtgatggaaaccatgaagcgcatggcagccatcgtcgacaagcagaacgaaggcgacccg
ctttatcgcccgatggccgctgattttgacaagtcgattgccttccaggcggcttgcgat
ctggtcttcaagggccgcgaacagccgaacggctacaccgagccggtcctgcatcgccgc
cggctcgaactgaaacaggcttcctga

DBGET integrated database retrieval system