KEGG   Brucella microti: BMI_I1827Help
Entry
BMI_I1827         CDS       T00955                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmr  Brucella microti
Pathway
bmr00010  Glycolysis / Gluconeogenesis
bmr00620  Pyruvate metabolism
bmr00640  Propanoate metabolism
bmr00680  Methane metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr01130  Biosynthesis of antibiotics
bmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMI_I1827
   00620 Pyruvate metabolism
    BMI_I1827
   00640 Propanoate metabolism
    BMI_I1827
  Energy metabolism
   00680 Methane metabolism
    BMI_I1827
Enzymes [BR:bmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMI_I1827
Lipid biosynthesis proteins [BR:bmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMI_I1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACU48777
UniProt: C7LE42
Position
1:1747755..1749710
Genome map
AA seq 651 aa AA seqDB search
MSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRIDWFKPFTKVKNTDFN
GDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKKITYRELYENVCRMAN
VLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTF
VITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDLWYHQE
VASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGEI
YWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTA
LRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGG
ILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVADGNLCISDSWPGQMRTVYGD
HKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHH
SVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHVRKEIGPIATPDKIQF
APGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaac
gagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaag
cacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaac
ggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatc
gaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccc
tatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaat
gtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatc
ccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtc
tttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttc
gtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacacc
gataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtg
cgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaa
gtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttc
attctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggc
tacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatc
tactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccg
ctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggc
cgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcg
ctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctg
cgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaat
gtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggc
atcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccg
ttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagcc
gacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgac
cacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgat
ggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctg
aatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcac
tcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctat
tgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaa
ctggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagttt
gcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatc
gccgaagacgagttcggcgcattgggcgacacctcaacgctcgccgatccgggcgtggtg
gacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system