KEGG   Brucella microti: BMI_I1860Help
Entry
BMI_I1860         CDS       T00955                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bmr  Brucella microti
Pathway
bmr00330  Arginine and proline metabolism
bmr00332  Carbapenem biosynthesis
bmr01100  Metabolic pathways
bmr01130  Biosynthesis of antibiotics
bmr01230  Biosynthesis of amino acids
Module
bmr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMI_I1860 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BMI_I1860 (proB)
Enzymes [BR:bmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BMI_I1860 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF3708
Motif
Other DBs
NCBI-ProteinID: ACU48810
UniProt: C7LE75
Position
1:complement(1782910..1784046)
Genome map
AA seq 378 aa AA seqDB search
MLKKLKDYRRIVVKIGSALLVDRATGLKREWLESLGQDIAALQHAGVEVLVVSSGAIALG
RTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQILVTLSDTEERRRYLN
ARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATMMGADLLILLSDIDGLYT
APPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKLDAGKIANAAGTAMIITSG
TRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSGKSLLP
AGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARKVAGHKSDEISAILGYDARAA
MIHRNDLVVRAASDAKAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaactgaaagactatcgccgcatcgttgttaaaataggctctgcccttctg
gtggaccgggccacaggcctgaagcgcgaatggctggaaagcctggggcaggatattgcc
gccttgcagcatgcgggcgttgaggtgctggtggtttcgtcgggtgcaattgcactgggg
cgcacggttctgggcctgccgaaaaaggcgctgaagcttgaggaaagccaggcggcggca
gcagccgggcagattgcgctggcgaaggcttatgcggatgtgctgggcggacatggcatc
aagtcgggacagattctggtcacgctttccgatacggaagagcgccgccgctatctcaat
gcgcgcgcaaccatcgagaccctgctgaagctcaaggccgtgccgatcatcaatgaaaac
gatacggtggcaaccaccgaaatccgttatggcgacaatgacaggttggcggcgcgcgtc
gcgaccatgatgggcgcggaccttctgatcctgctttccgacattgacgggctttatacc
gcgccgccgcacaagaatccggatgcgcaatttctgccctttgtcgaaaccatcacgccg
cagatcgaagccatggcgggggcggcagcatccgagctttcgcggggtggcatgaagacc
aagctcgatgcgggcaagattgcaaacgctgccgggaccgcgatgattatcacttcgggc
acgcgtttcggcccgctttcggcaattgaccgaggggagcgtgcgacattgttcgaggct
gcccatgcgccggtcaatgcgtggaagacgtggatttccggcaatctggaaccggctggc
cggttgactgtggatgcgggtgctgtcaaggcgctcaaatccggcaaatcgcttttgcct
gcgggcgtgaaggaagttgacggggatttcgagcgtggcgacacggttgccgtcatgaac
gaggatgggcgggagattgcgcgcggtctgatcgcctatgatgctgctgacgcccgcaag
gttgccgggcataaaagcgatgagatcagtgccattcttggctatgatgcccgcgcggcg
atgatccatcgcaacgatctggtggtgcgggccgccagcgatgcgaaagccgcatag

DBGET integrated database retrieval system