KEGG   Brucella microti: BMI_I1925Help
Entry
BMI_I1925         CDS       T00955                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmr  Brucella microti
Pathway
bmr00020  Citrate cycle (TCA cycle)
bmr00190  Oxidative phosphorylation
bmr00650  Butanoate metabolism
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr01130  Biosynthesis of antibiotics
bmr01200  Carbon metabolism
Module
bmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMI_I1925 (sdhD)
   00650 Butanoate metabolism
    BMI_I1925 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMI_I1925 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: ACU48867
UniProt: C7LED2
Position
1:complement(1847599..1847994)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtactccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system