KEGG   Brucella microti: BMI_I2109Help
Entry
BMI_I2109         CDS       T00955                                 

Gene name
coaA
Definition
pantothenate kinase (EC:2.7.1.33)
Orthology
K00867  
type I pantothenate kinase [EC:2.7.1.33]
Organism
bmr  Brucella microti
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:bmr00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2018462..2019430
Genome map
AA seq 322 aa AA seqDB search
MWEKVDQLTPSRYSPYRFFSAQEWAAFRADTPLTLTYEEVKRLRSLGDPIDLDEVRRIYL
SLSRLLYAHVEASQLLFRQRQQFLNMEESYKTPFIIGVAGSVAVGKSTMARILKELLARW
PSSPKVDLVTTDGFLYPNAVLREQNMMERKGFPESYDIGAVLRFLSAIKAGMSRVRAPLY
SHLSYDVLPGEYQIVDKPDILIFEGINVLQVRDLPEDGKMVPFVSDFFDFSIYIDADPRL
IHKWYIDRFMRLRETAFRDPQSFFHRYSQLSQEAARSIAEGLWQNINLKNLNENILPTRP
RADLILRKGSDHLIEEVALRKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaaaagtcgatcagctcaccccgtcccggtattcgccctaccgcttcttttcg
gcgcaggaatgggcagccttccgggccgatacaccgctcaccctcacctatgaagaggtc
aagcggctgcgctcgctgggcgacccgattgatctggatgaagtgcggcgcatctatctg
tcgctctcgcggcttctttatgcgcatgtggaggcaagccagcttctgtttcgccagcgc
cagcaattcctcaacatggaggaatcctacaagacccccttcatcatcggtgtggccggg
tccgtggcggtgggcaagtccaccatggcacgtatcctcaaggagcttctggcccgctgg
ccgtcaagccccaaggtcgacctcgtgacgaccgacggttttctctatcccaacgcggtc
ctgcgcgagcagaacatgatggagcgaaagggctttcccgaaagctacgatattggcgcg
gtcctgcgcttcctgtcggcgatcaaggcgggcatgagccgtgtgcgcgcgccgctctat
tcgcatttgagctatgatgtgctccccggcgagtaccagatcgtcgacaagcccgatatt
ctgatttttgaaggcattaacgtgttgcaggtgcgcgatctgccggaagacggcaagatg
gtgcctttcgtatcggatttcttcgatttctcgatctatatcgatgccgatccgcgcctg
atccataaatggtatatcgaccgcttcatgcgcctgcgtgaaacggcgtttcgcgacccg
caatccttcttccatcgctattcgcagctttcgcaggaggcggcccgctccatcgccgag
ggcctctggcagaatatcaacctgaagaacctgaatgagaatattctgcccacccgcccc
cgcgccgatctcatcttgcgaaaaggcagcgatcatctgattgaggaagtggctctcagg
aaaatctga

DBGET integrated database retrieval system