KEGG   Brucella microti: BMI_I789Help
Entry
BMI_I789          CDS       T00955                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmr  Brucella microti
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(774948..775898)
Genome map
AA seq 316 aa AA seqDB search
MPSKTIDHAITARSLTSAATDPTHAGVLSFMRRTYSKSLKGAEAVVWGIPFDAAVSNRPG
ARFGPQASRRASAIFDNDPQYPFERDLFENLAVIDYGDCLLDYGNHTKTPSTIEREAAKI
LKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTWFDDGRRIDHGSFVARAV
RDGIIDPDLSIQIGIRTHAPEDCGIRIIYGHEVEDMPAAAIADAILKRTNGRKAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTALDFVGADVVEVAPAYDHADITAIAGAT
IAMYYLGLLGERKERR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaagaccatcgaccatgcgatcactgcccgcagcctgaccagtgcggccacc
gacccaacccatgcgggcgtcttgtccttcatgcggcgcacttactccaagtcgctcaaa
ggcgcggaagcagttgtctggggcattcctttcgatgccgccgtttccaaccggcccggc
gcacgcttcggcccgcaggcgagccggcgcgcctcggcgatcttcgacaacgatccgcaa
tatccgttcgagcgtgatcttttcgagaatctcgctgtcatcgattatggcgactgcctg
ctcgactatggcaatcacaccaagacaccctccaccatcgagcgtgaagcagcaaaaatc
ctgaaatccgatgcatttctgctgacgctcggcggcgatcatttcatcacatggccgctt
ctcaaggcccatgccgcaaaatacggccccctcgctctggtgcagttcgatgcgcatcag
gatacatggttcgatgatggcaggcggatcgaccacggctccttcgtggcccgcgcggtg
cgcgacggcatcatcgatcccgacctttcgatccagattggcatccgcacgcatgcgccg
gaagattgcggcatcaggatcatttatggccacgaggtcgaggatatgccagcggcggcg
attgccgatgcaatcctgaaacgcaccaatggcaggaaagcctatctgaccttcgacatt
gactgtctcgatccggcttttgcgccgggaaccggcacgccggttgcaggcggcccctcc
tcggcaaagatgctgtctgtcctgcgcaagctgacggctcttgacttcgtgggcgccgat
gtagtcgaggttgcaccggcctatgaccatgccgatataacagccatcgcgggagcgacg
atcgcaatgtattatctgggccttctgggcgaacggaaagaacgacgatga

DBGET integrated database retrieval system