KEGG   Brucella microti: BMI_I884Help
Entry
BMI_I884          CDS       T00955                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmr  Brucella microti
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:864150..864749
Genome map
AA seq 199 aa AA seqDB search
MRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRTAPLDCGEYMEGIDDQARVISALK
LEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKLCDHALQQFVSLKRENIMVKHTDG
RHGMPGGPFDRIVIWLACDEVPRHFVELLATHGVLIAPIGPGDGRQIMTRISKVGSRFEQ
EDLMPVRYQPFIEGTSSVL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagcaacgccgcgc
cagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaaccgcgccgctt
gattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttccgccctgaag
cttgagcccggccatcgggttctggaaatcggcaccggctccggctttaccgccgccgtt
atgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactctgcgaccac
gctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacatacagacggg
cgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgcatgcgatgag
gtgccgcgccatttcgttgaactgctcgccacccatggcgtcctgatagccccgatcggc
cctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgttttgaacag
gaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttccgttctttag

DBGET integrated database retrieval system