KEGG   Brucella microti: BMI_II171Help
Entry
BMI_II171         CDS       T00955                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
bmr  Brucella microti
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMI_II171 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMI_II171 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:160994..161389
Genome map
AA seq 131 aa AA seqDB search
MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGR
HSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFL
KQYDLGGKIKE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtc
gcgcaaggggcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccat
cagattggtgagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgt
cactcgggttccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtc
tgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagacc
aagatggtctatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctc
aagcagtatgatctgggtggcaagatcaaggaataa

DBGET integrated database retrieval system