KEGG   Brucella microti: BMI_II382Help
Entry
BMI_II382         CDS       T00955                                 

Gene name
xfp
Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bmr  Brucella microti
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMI_II382 (xfp)
Enzymes [BR:bmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BMI_II382 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(366825..369194)
Genome map
AA seq 789 aa AA seqDB search
MPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGTTPG
LNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGMERLF
RQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAETGAL
ATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARLSDDDLDNLFRGYGYEPFFVEGS
EPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPRWPMIILRSPKGWTGPKTVDGLVVE
NYWRAHQVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALKPELRALAPKGEARMGAN
PHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNETEKNFRIFGP
DETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGRHGF
FSCYEAFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQDPGF
VDLVANKSADIVRVYFPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHC
EAGLGIWEWAGTEDGLEPDIVMACAGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVL
QSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQGTT
TTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDMPEI
RDWKWTWPR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
gtgccagcaaaagggcctctcacaccgcagcagctttcactcatcaaccgttactggcgc
gcggcgaattatctttccgtcggccagatttatctgatgaaaaatcccctgttgcgcgaa
ccgctccagcctgagcacatcaagccgcggcttctcggccattggggcacgacacccggc
ctcaatttcatctatgcgcatctcaaccgcattattcagcagcgcaacgccaatgtgatc
tatatttgcggccccggccatggcgggccgggcatggtggccaacacctatctggagggc
acctattccgaaatctatcccgcaatcagcgaagatgaagcgggcatggaaaggctcttc
cgccagttttccttccccggcggaataccaagccatgccgcgccggaaacaccgggctct
atccacgaagggggcgaactgggttatgcgctcgtccacgcctatggtgcggccttcgac
aatcccgatctggtggtggcctgcgtcgtgggcgacggagaagcggaaaccggcgcgctt
gcaacttcgtggcactccaacaaattcctcaatccggcgcgcgatggtgcggttctgccg
atcctgcatctcaatggctacaagatcgccaaccccaccgtgctggcccgcctttcggat
gatgatctggacaatcttttccgtggctacggttatgagcctttctttgttgaaggcagc
gagcctgccgacatgcaccagaagatggccgcaacactggacacgattttccagcgcatt
caggacatcaagaaaaatgccgatgtgcactcgcccgagcgcccgcgctggccgatgatt
attctcagaagcccgaagggctggaccggcccaaaaaccgtggacggtctggttgttgaa
aactattggcgcgcccatcaggtgccggttgccaattgccgcgaaaacgatgcccatcgc
aaaatcctcgaagactggatgaagagttacgacccgtccgatctgttcgacgaaaaaggg
gcgctgaagcctgaattgcgggcgctggcgccaaagggtgaagcgcgcatgggggccaat
ccgcatgccaatggcgggctcttgcgtaaagagcttcacatgccggatttccgccaatat
gcggtcaatgtcaccgaaccgggagcgatagaagcgcaatcaaccaaaatattgggcgat
tttctgcgcgatgtgatgaaactgaacgagacggaaaagaacttccgcatcttcggcccc
gacgaaaccgcctccaacaggctcggcagcgtattagaggcgacgaaccgggtctggatg
gccgaaacgctggacatggatgaccacctcgccgccgacgggcgtgtaatggaggttctc
agcgaacatctctgccagggctggcttgaaggctatcttctcagtggccggcacggcttc
ttttcctgctacgaagccttcatccacattatcgattccatgttcaaccaacatgccaaa
tggttgcaggttgcgcgcgaactggaatggcgcaagcccatctcatcgctcaattatctg
ctgacctcccatgtctggcggcaggaccataacggcttctcccatcaggatcccggcttc
gtcgatctcgtcgccaacaaaagcgccgatatcgtgcgtgtctatttcccgccggatgcc
aacacccttttgtgggtgggagatcactgcctgaaaacctggaaccgcgtgaatgtcatc
gtggcgggcaagcagccggaaccgcaatggctgaccatggcggaggctgagaaacattgc
gaagcaggtctcggcatatgggaatgggcgggcacggaagacgggctggagccggatatc
gtcatggcctgcgcgggcgatgtgccgaccatggaaacgcttgccgcggttgatcttctg
cgccagtccctgccgcatctgcgcattcgcgtggtgaatgtggttgacctcatggtgctg
caatcgccgcatcagcacccgcatggcatttccgatgaggaattcgaccggatgttcacc
accaacaggcccgtcatcttcgcctatcacggctatccttatctcatccatcgactggtc
tataagcgcaccaaccactccaatttccacgttcgtggttttatcgagcagggaacgacc
acaacgcctttcgacatgaccgtgctgaacgagctggatcgtttccacctcgcgatggaa
gccgtcgagcgcctgccgctgggcgaaagcgttgccaaacccctgatcgacaatttcacg
gagaaacttgcgctgcataaggactatatccgacagcatggtgaggacatgccggaaatc
cgcgactggaaatggacatggccgcgataa

DBGET integrated database retrieval system