KEGG   Brucella microti: BMI_II440Help
Entry
BMI_II440         CDS       T00955                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmr  Brucella microti
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMI_II440 (glpK)
Enzymes [BR:bmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMI_II440 (glpK)
Exosome [BR:bmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMI_II440 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(431776..433272)
Genome map
AA seq 498 aa AA seqDB search
MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWVEHDAEEIWKSVQSTIR
IALAQAGISAADVAAIGITNQRETTVVWDRISGKPVHRAIVWQDRRTAQFCDELKRRNLE
PLFTEKTGLLLDPYFSGTKLAWLLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVT
DATNASRTLIYHIGENRWDDELLDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGV
AGDQQAAVIGNACFEPGMMKSTYGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYAL
EGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARG
AIFGLTRGTGRAEFARAALESVAYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQ
RLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERE
SAIAGWRDSVSRCLTRPQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatattctggctatcgatcagggaaccacctccacaaggtcgatgctgttc
gacaggaatatgcgggtcgtggggttggggcagcaggaatttacgcagcattttccttcc
tccggctgggtggagcacgatgcggaagaaatctggaaatcggtgcagtccactatccgc
atagcacttgcacaagctggcatcagtgcggcagacgtcgcggcgatcggcatcaccaat
cagcgcgaaacaaccgtcgtatgggaccgcataagcggcaagccggtacaccgcgccatt
gtctggcaggatcgccgcacggcgcagttttgcgacgaactgaagcgccgcaatcttgaa
cctctctttacggaaaagaccgggctgctgctcgacccctatttttccgggacgaaactt
gcatggttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgc
ttcggcaccatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaacc
gacgccacgaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgat
gaactgctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcg
gcggatttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgta
gcgggcgaccagcaggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaa
tccacctacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcc
tccaaccggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctg
gaaggttcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttc
atttcggtcgcatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatc
tatctggttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggc
gcaatcttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaa
agcgtggcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggcgca
accaatcacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcag
cgactggccgacattctgaacgcacccgtcgatcgcccggtttttctcgaaaccaccgtg
ctgggcgccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttt
tcggaacgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaa
agcgcgattgcgggctggcgggatagcgtttcacgctgcctcacacgaccgcaatag

DBGET integrated database retrieval system