KEGG   Brucella microti: BMI_II445Help
Entry
BMI_II445         CDS       T00955                                 

Gene name
phbA-2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmr  Brucella microti
Pathway
bmr00071  Fatty acid degradation
bmr00072  Synthesis and degradation of ketone bodies
bmr00280  Valine, leucine and isoleucine degradation
bmr00310  Lysine degradation
bmr00362  Benzoate degradation
bmr00380  Tryptophan metabolism
bmr00620  Pyruvate metabolism
bmr00630  Glyoxylate and dicarboxylate metabolism
bmr00640  Propanoate metabolism
bmr00650  Butanoate metabolism
bmr00900  Terpenoid backbone biosynthesis
bmr01100  Metabolic pathways
bmr01110  Biosynthesis of secondary metabolites
bmr01120  Microbial metabolism in diverse environments
bmr01130  Biosynthesis of antibiotics
bmr01200  Carbon metabolism
bmr01212  Fatty acid metabolism
bmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMI_II445 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BMI_II445 (phbA-2)
   00640 Propanoate metabolism
    BMI_II445 (phbA-2)
   00650 Butanoate metabolism
    BMI_II445 (phbA-2)
  Lipid metabolism
   00071 Fatty acid degradation
    BMI_II445 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BMI_II445 (phbA-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMI_II445 (phbA-2)
   00310 Lysine degradation
    BMI_II445 (phbA-2)
   00380 Tryptophan metabolism
    BMI_II445 (phbA-2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMI_II445 (phbA-2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMI_II445 (phbA-2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMI_II445 (phbA-2)
Enzymes [BR:bmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMI_II445 (phbA-2)
Exosome [BR:bmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMI_II445 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACU49578
UniProt: C7LHU0
Position
2:complement(437345..438535)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system