KEGG   Brucella microti: BMI_II48Help
Entry
BMI_II48          CDS       T00955                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bmr  Brucella microti
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMI_II48
Enzymes [BR:bmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMI_II48
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(42211..43206)
Genome map
AA seq 331 aa AA seqDB search
MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRGTVIVLQGRNEFIENYY
ETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDYADDLDHFLTGIVLPDCPP
PFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQKISDDNVRRITAALRWIGLG
RIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTYTDLALGGPTVRWVWSALETAWR
INQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVARTRNISLAVIDGARHEMLQEADFYR
EQVLAAFDAFIPGSSPVESMPQSLEPDLSQI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactgctttttgaaaccgatgcaaatccgatcccgagccgaataagaggcggt
cttttccatgcgccggacgggaaggccctgcgctacgccctgctgaaagccgaaagccgg
ccgtgccggggcacggtcatcgtgcttcagggccgcaacgaattcatcgaaaattattat
gaaaccatgtccgacctcgccgggcgcggttttaccgttgccaccttcgactggcgcggc
cagggcggctcgcatcgcctgctgcgcgaccgcctgcgcggctatgtgcgcagcttcaac
gattatgccgacgatctcgaccatttcctgaccggaatcgtgctgcccgactgcccgccg
ccatttttcattctcgctcactcggcaggtgcgctggtcgcgctttcctcactggaacgg
ctctcctcccgcatcacccgcatggtgctttgcgcgcccctgatggggcttggcgggcag
aaaatcagcgatgacaatgtgcgccgcattaccgccgcgctgcgctggatcggcctgggg
agaatctatgcggcaggcgggcgcaccctgtcggcggcgcgcgcctttgccgacaatcca
ctgaccagtgatccgttacggttcatgcgcaatgtggaaatcacacggacttatacggac
ctcgcgcttggcggccccaccgtgcgctgggtctggagcgcactggaaaccgcatggcgc
atcaaccagccggatttttacaaaagccccatcgcgccggttctgattatcgcggctggt
gctgaccgcgttgtttcaacagcggtgatcgagcgtttcgtggcgcgcacgcgaaacatc
tcgctcgccgttattgacggtgcgcgccacgaaatgctccaggaagcagatttctaccgc
gaacaggtgctggcggctttcgacgccttcatccccggctcatcgccggtggaatccatg
ccccaaagtcttgaacccgacctctctcaaatctaa

DBGET integrated database retrieval system