KEGG   Brucella suis 1330: BR0465Help
Entry
BR0465            CDS       T00096                                 

Definition
tldD protein
Orthology
K03568  
TldD protein
Organism
bms  Brucella suis 1330
Brite
Peptidases [BR:bms01002]
 Peptidases of Unknown Catalytic Type
  Family U62
   BR0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(463237..464649)
Genome map
AA seq 470 aa AA seqDB search
MKSLIDSFDTGRDHIERLVAESLKGSDDGELFLEYREAEALVFDNGRLKTGSFNQDQGFG
LRSVAGEAIGYAHAGDLSLAALKRASDAVSATLKGYGGTYSPAPAGTNRHLYTDENPIGA
PGFDAKVQLLQQIDAYLRAKDTKVRQVSVSLACSWQQVEILRADGHFVRDIRPMARLSVS
VVAGSGDRQESGSYTLGGRKGFGEFITTESWQHAADEALRQALVNLEAIPAPAGTFDIVL
ANGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGQQVAATGVTVVDDGTIAERRGSLTID
DEGTPTNRTVLIEDGKLVNYMQNRQNARLMGMEATGNGRRESYAHAPMPRMTNTYMLSGD
KTPEEIIASIRKGIYAVSFGGGQVDITSGKFVFGCTEAYMIEDGKVGAPIKGAMLIGNGP
DAMKRISMIGNDMKLDTGSGNCGKGGQWVPVGVGQPHLRMDQITVGGTAV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtctgatcgacagtttcgacaccggccgcgaccacatcgagcgccttgtggcg
gaaagcctcaagggcagcgacgatggcgaactcttccttgaatatcgcgaggcagaggcg
ctcgtctttgataatggccgcctcaagaccggctcttttaatcaggatcagggttttggc
ctgcgctctgtcgcgggcgaggccatcggctatgcccatgcgggcgacctttcgcttgcc
gcgctgaaacgcgcctccgacgccgtttccgccacgctgaaaggctatggaggcacttat
tcccccgctccggctggcaccaaccgccatctctacacggacgaaaacccgatcggcgca
ccgggcttcgacgccaaggtgcagcttctgcaacagatcgacgcctatctgcgcgccaag
gacacgaaagtgcggcaagtatctgtttcgcttgcatgctcttggcagcaggtggaaatc
ctgcgcgccgatggtcatttcgtgcgcgatattcgccccatggcccgcctcagcgtttct
gtcgtggcaggcagcggcgaccggcaggaatccggctcgtacacgctcggcgggcggaaa
ggttttggcgaattcatcaccacggaaagctggcagcacgcagccgatgaggccttgcgg
caggcgctcgtcaatcttgaggccattcccgcccctgcgggcacattcgacatcgtgctt
gccaatggctggccgggcgtgatgctgcatgaggccgtgggccatggacttgaaggcgat
ttcaaccgcaagaagacgtccgcctttgccggtcttctcggccagcaggtcgccgccacg
ggggtaaccgtggtggatgacggcacgattgccgagcgccgcggatcgctgaccatcgac
gatgaaggtacgccgaccaaccgcaccgtgctgatcgaggacggcaaactcgtcaactac
atgcagaaccggcagaatgcacggttgatgggcatggaagcaaccggcaatggacgccgc
gaatcctatgcacacgcgcccatgccgcgcatgaccaacacctatatgctatcaggcgac
aagacgccggaagagatcatcgcctcgataaggaagggcatttatgccgtttccttcggc
ggcggccaggtggatatcacatcgggcaagttcgtgttcggctgcaccgaggcctatatg
atcgaagacggcaaagtgggcgcgcctatcaagggggcgatgctgatcggcaacgggccg
gatgcgatgaagcgtatctccatgatcggcaacgatatgaagcttgataccggcagcggc
aattgcggcaaaggcgggcagtgggtgccggtcggtgtcggccagccccatctgcgcatg
gatcaaatcacagtcggaggcactgctgtctag

DBGET integrated database retrieval system