KEGG   Brucella suis 1330: BR0484Help
Entry
BR0484            CDS       T00096                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bms  Brucella suis 1330
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BR0484 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BR0484 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BR0484 (thrC)
Enzymes [BR:bms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BR0484 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(482770..484161)
Genome map
AA seq 463 aa AA seqDB search
MKYVSTRGEAPVLEFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT
PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA
RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS
GFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDALSLSGVNSINWARIMPQVVYYFTAALS
LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV
AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA
GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK
AACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVRHHSRA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaagtacgcgtggggaagcaccggttctggaattcagcgatgcattgctc
gcaggcctcgcccgtgatggcggtctttatctgccgcaggaatatccgcaattcacagcc
gaacagatccgcgccctgcgtggaaaatcctatgtcgaagtcgcgctggccgtcctcacg
ccctttaccggcggtgaaattccggcagccgatttcgagcgcatggtccgcgaagcttac
ggaaccttccgtcacgatgccgtctgcccgttggtgcagaccgacgcgaacgaattcgtg
ctggagcttttccatggccccacccttgccttcaaggatgtcgccatgcagcttctggcc
cgcatgatggattatgttctggcacagcgcggcgagcgcgcaacgatcgtcggcgctaca
tccggcgatacgggcggcgcagccatcgaagcctttggcgggcgcgacaacacagacatt
ttcatcctgttccccaatgggcgggtctcgccggtacagcaacgccagatgacgtcttcc
ggcttttccaatgtccatgcgctttccatcgagggcaatttcgacgattgccagaacctc
gtaaaaggcatgttcaatgatctggaattccgtgacgccctgtcgctttccggcgtgaac
tcgatcaactgggcgcgcatcatgccgcaggttgtctattatttcacggcagcactcagc
ctcggcgcaccggaccgcgccgtgtccttcacggtgcccaccggcaatttcggcgatatt
ttcgcaggctacgtcgccaagcgcatgggcctgcccatcgagcaactcatcatcgccacc
aacgacaacgatattctttcgcgcacgctggaaagcggggcctatgagatgcgcggcgta
gcgcagaccacttcgccctcaatggatatccagatttcctccaatttcgagcggcttctg
ttcgaggcacacgggcgcgatgcggcggccgtgcgcgggctgatgcagggcctgaagcaa
tctggcggatttacgatttccgaaaagccgctttcggccatccgcagcgaattttcggct
ggccgctccaccgtcgatgagacggcggcgactatcgaatcggttctttccaaagacggc
tatctgcttgatccgcattcggcgatcggtgtgaaggtcgcgcgtgaaaaagcatccggc
accgccccgatggtggttctggcgaccgcccatccggccaaattcccggatgcggtgaag
gctgcatgtggggtcgagccgcaattgccggcatggctttgcgacctgatgcaacgaaaa
gaaagcttcacagttcttcacaacgagctgaaaatcgtggaagaatatgtgcgccaccat
tcccgagcctga

DBGET integrated database retrieval system